KEGG   Bacillus licheniformis ATCC 14580: BL00403Help
Entry
BL00403           CDS       T00197                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BL00403 (pfkA)
   01230 Biosynthesis of amino acids
    BL00403 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL00403 (pfkA)
   00030 Pentose phosphate pathway
    BL00403 (pfkA)
   00051 Fructose and mannose metabolism
    BL00403 (pfkA)
   00052 Galactose metabolism
    BL00403 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BL00403 (pfkA)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BL00403 (pfkA)
Protein phosphatases and associated proteins [BR:bli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BL00403 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2954337..2955296)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKYGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDLTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAESILIPEADYDMEEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEATNL
ETRVSVLGHIQRGGSPTAADRVLASRLGAFAVELLLEGKGGRCVGIQNNQLVHHDIIEIL
EQKHTIDQSMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatcggagtattgacaagcggcggagattccccgggaatgaacgcggcggtc
cgcgcggttgtcaggaaagcgatctaccatgacgtagaagtatacggaatttacaacggg
tattcaggtttaatcagcggaaaaatagaaaagcttgaaatcggttctgtcggagatatc
attcaccgcggaggaacgaagctatatacagcaaggtgtcctgagtttaaaacggtagaa
ggacgggaaaaaggaatagcgaatttaaaaaaatatggtatagaaggattagtcgtcatt
ggcggcgacggttcttatatgggagccaaaaagctcacagaacacggttttccttgtgtg
ggagtgccgggaacgatcgacaatgacatcccaggcactgatctgacgatcggattcgat
acggcgctaaataccgttattgacgccatcgataaaatcagggatacagctacatcccat
gaacgtacatacgtgattgaagtaatgggccgccatgccggggacattgctttatggtca
ggtttggccggaggcgcggaatccattttgattcctgaagcagactacgatatggaagaa
attattgcaaggctgaaaagagggcatgagcgcggcaagaaacacagcatcatcattgtg
gcggaaggcgtcggcagcggcgttgaattcggaaaaagaattgaagaagccacaaatctc
gaaactagagtatcggtgcttggacatatccagcgcggcggttccccgactgcagcagac
cgcgtattggcaagccgtctaggggcatttgcggttgaactgcttcttgaaggaaaaggc
ggacgttgtgtaggaattcaaaataaccagcttgtgcatcatgatatcattgaaatactc
gagcaaaaacatacaattgatcaaagcatgtaccgcttgtctcaagaactgtcaatctag

DBGET integrated database retrieval system