KEGG   Bacillus licheniformis ATCC 14580: BL00469Help
Entry
BL00469           CDS       T00197                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BL00469 (hemD)
Enzymes [BR:bli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BL00469 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2727491..2728318)
Genome map
AA seq 275 aa AA seqDB search
MGKGLNGRRIAIGASRKTDEMSTLIKKQGGVPLIRSLQGTVFLAEKEVGPDLRAFVETGA
DWVIFTTGIGTETLVSLAEKLGIGERYLQAIRRAKAASRGYKTIAALKKLGITPVAADED
GTTKGLIDSLQSHDFSGKRVMVQLHGENAPSLLQFLEEKGADVVPLLPYRHVAPDRETVA
LLCSEIINREVDAVCFTTAVQVRSLFHFAKENGYAEKIVQSFQDSVLAAAVGKVTAEALR
EEGVERLLAPDLERMGAMIVELARFYETEEGIRTQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaaaggattgaacggcagaagaattgccatcggagcatcgcgaaaaacggatgaa
atgagcacgctgatcaaaaagcaaggcggggttcccctcattcgctcccttcagggtacc
gtgtttttggccgaaaaagaagtaggccctgatttgcgtgccttcgttgaaacgggagcc
gactgggtgattttcacgaccggaatcgggacggaaacgcttgtcagcctagctgagaaa
cttgggatcggagagcgctatttacaagcgatccgcagggcgaaagcggcatcgagaggc
tacaaaacaatcgccgctttaaaaaagctcggcattacgcccgttgcggcggatgaagac
ggcacgaccaagggactgatcgactcgctccaatcccacgatttttccggcaaacgggtg
atggttcagctccacggcgaaaacgctccgtcactgcttcagtttttggaagagaaaggt
gcagacgttgttccgcttctgccgtatcggcatgttgctccagaccgggaaaccgtcgct
ttattgtgcagcgagatcatcaaccgtgaagtggatgcggtttgctttacaacggctgtc
caagtccgctcgctttttcatttcgcgaaagaaaacggctatgcggagaaaattgttcaa
tcttttcaagacagcgtgttggcggccgctgtcggaaaagtgacggcagaagctttaaga
gaagaaggagtcgaacgccttctcgctccggatctcgaacggatgggagcgatgattgtg
gagctagcgcggttttatgaaacggaagaggggataagaacacagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system