KEGG   Bacillus licheniformis ATCC 14580: BL00517Help
Entry
BL00517           CDS       T00197                                 

Gene name
spoVC
Definition
(GenBank) peptidyl-tRNA hydrolase
  KO
K01056  
peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
Enzymes [BR:bli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     BL00517 (spoVC)
Translation factors [BR:bli03012]
 Eukaryotic Type
  Release factors
   BL00517 (spoVC)
 Prokaryotic Type
   BL00517 (spoVC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
64255..64821
Genome map
AA seq 188 aa AA seqDB search
MLVFAGLGNPGKTYENTRHNVGFMTIDELSKEWNIPLDKTKFNGQYGIGFVSGKKVLLVK
PLTYMNLSGECLRPLLDYYEIPVDNLKVIYDDLDLPTGRIRLRTKGSAGGHNGIKSTIQH
LGTSEFNRIRIGIGRPVNGMKVVDYVLGAFTDEEEPAIKEAVRQSAKACEASLEKPFLEV
MNEFNAKV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgtttgcaggattgggcaatccgggtaaaacatatgaaaatacgagacacaat
gtaggttttatgacgattgacgagctctcgaaagagtggaacattccgcttgataaaaca
aagttcaacggacaatacggaatcgggtttgtttccggcaaaaaggttctacttgttaag
ccgcttacatatatgaatttatcgggagaatgtttgaggccgcttttggactattacgag
atccctgttgacaatttgaaagtgatttacgatgatttggatcttccgaccggaagaatc
cgtctgaggacgaaaggaagcgcaggaggccataacggcatcaaatcgacgattcagcat
ctgggaacaagtgagtttaaccggatcagaatcggaataggccgtccggtaaacggcatg
aaagtcgtcgattatgtgcttggcgcttttacagatgaagaagagccggcgataaaagag
gccgtcagacaatcggccaaggcctgtgaagcttctttggaaaaaccttttttagaagtc
atgaatgaatttaacgcaaaggtataa

DBGET integrated database retrieval system