KEGG   Bacillus licheniformis ATCC 14580: BL00550Help
Entry
BL00550           CDS       T00197                                 

Gene name
ytcI
Definition
(GenBank) AMP-dependent synthetase and ligase YtcI
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00010  Glycolysis / Gluconeogenesis
bli00620  Pyruvate metabolism
bli00640  Propanoate metabolism
bli00680  Methane metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL00550 (ytcI)
   00620 Pyruvate metabolism
    BL00550 (ytcI)
   00640 Propanoate metabolism
    BL00550 (ytcI)
  Energy metabolism
   00680 Methane metabolism
    BL00550 (ytcI)
Enzymes [BR:bli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BL00550 (ytcI)
Lipid biosynthesis proteins [BR:bli01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BL00550 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAU24602
UniProt: Q65G54
Position
complement(2982494..2984083)
Genome map
AA seq 529 aa AA seqDB search
MRREDLIAPEKYNAVDEIEKFKSSRDKTALIWEDESGRQVSWSYEKLIEKAYKIGSILTR
SGLKKGDKLIVMMPRIPETYAVYMAILKAGMVVIPCSEMLRAKDLDYRIKHAGVKGAVVY
SAFLDAFLDVRSKEALSLFAVGESSEGWINLLEKMNQAIAADFQAADTSRDDIAFLSYTS
GTTGQPKGVVHTHGWAYAHLRTTASAWLDISEGDLVWATAGPGWQKWVWSPFLAVLGSGA
TGFIYHGKFTPETYLRLIERHQVNVLCCTPTEYRFMAKVNDLSRFDLSSLHSAVSAGEPL
NREVIDTFKKHFHIAVRDGYGQTESTLLVGILKGMKIKPGSMGKPTPGNLVDIIDGNGKS
CPPGETGDIAVHLSTPALFKEYYKDQERTLRQRRGDYFITGDKARKDEDGYFWFESRNDD
VIISSGYTIGPFEVEDALIKHPEVKECAVVASPDEIRGSIVKAYVVLKDPSRGNEHLTKE
LQDHVKAMTAPYKYPREIEFIEELPKTPSAKIKRFELRQREIALKTKAE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagagaagatttgattgcgccggagaagtataatgcggttgatgaaattgaaaaa
tttaaatcttcccgcgataagaccgcattgatctgggaagatgaatcagggcgtcaagtg
tcatggtcctatgaaaaattgattgaaaaggcttacaaaatcggcagcatattgacccgt
tctggactgaaaaaaggtgacaagcttatcgtgatgatgccgcggataccggaaacgtat
gccgtgtacatggccattttaaaagctggaatggtggtcatcccatgttccgaaatgctt
cgggcgaaagacttggattacaggatcaagcatgcaggcgtcaaaggagccgtcgtatat
tcagcatttcttgatgcttttctagatgttcgttcaaaagaggcactgtcgttatttgcc
gtcggagaaagcagcgaagggtggatcaatctgctcgaaaaaatgaatcaggccattgca
gcggattttcaagcggcggatacctctcgcgatgacatcgcatttttatcttacacatcc
ggcacgaccggtcagccaaaaggggttgtacatacacacggctgggcttatgctcactta
agaacgacagcttccgcatggcttgacatttcggaaggggatctcgtctgggcgacagca
gggccgggctggcaaaaatgggtatggagcccgtttttagcagtgctcggtagcggtgca
accggctttatctatcatggaaaattcacgccggaaacgtatttgcggctgattgagcgc
catcaagtcaatgtgctgtgctgtacgccgacagagtaccggttcatggcgaaagtcaat
gatttgtcccgatttgacctgtcttctctgcacagcgctgtttcggccggagagccgttg
aacagggaagtcatcgatacatttaaaaagcattttcatattgctgtgcgggacggatac
ggacaaacggagagcacgctgttggtggggattttaaaaggtatgaaaatcaagcctgga
agcatgggaaaaccgacgcctggaaacttggttgatattattgacgggaatggaaagagc
tgtcccccgggcgaaacaggcgatattgccgttcacttaagcacgccggctctttttaaa
gaatattacaaagatcaagaacgaacgctccgacaaagaagaggggattactttataaca
ggggataaggcgcgaaaggatgaagacggctatttttggtttgaaagccgcaatgacgat
gtgatcatcagctcaggatatacaatcggcccgtttgaagttgaagatgcgctgatcaag
catcctgaggtcaaagaatgtgctgttgtggcaagccctgatgaaatcaggggatcgatc
gtgaaagcatacgttgtcttaaaggacccatcccgcggaaatgaacacctgacaaaggaa
ttacaagaccatgtaaaagccatgacggccccttataaatacccccgggagatagaattc
atcgaagaactgccgaaaacgccttcggcgaaaatcaagcgctttgaactaagacaacgg
gaaatcgcacttaaaacgaaagctgaataa

DBGET integrated database retrieval system