KEGG   Bacillus licheniformis ATCC 14580: BL00582Help
Entry
BL00582           CDS       T00197                                 

Gene name
sodF
Definition
superoxide dismutase
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2211425..2212270
Genome map
AA seq 281 aa AA seqDB search
MNRDAYKEKISSWAKDLKDQMKDDPSLESHLEKLFQSLDDPRATEQEWYEQAEAVYQAIS
RSDASQAGRQPFRTVPIGGHRLPSLPYSYSALEPYISKEIMFLHHTKHHQSYVDGLNRAE
KELQKARQTKQFDLVNHWERELAFHGAGHYLHTIFWYAMHPKGKRRPTGELLEMINRSFG
SYSAFKEHFSEAAKKVEGVGWAILVWAPRSHRLEILIAEKHQLMSQWDVIPLLPLDVWEH
AYYLQYKNEKAKYVDNWWNVVDWREPERRFASAKRVLWEPF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgaacagagatgcttacaaagaaaaaatatcgtcatgggccaaagacctgaaagaccag
atgaaagatgatccttctttagaaagccatttagaaaaactttttcaatcattggatgat
cctcgtgcgaccgaacaggaatggtatgagcaggcagaagccgtgtatcaagccatctcc
cgcagtgatgcgtctcaagcaggccggcagccattcagaacagtgccgatcggaggccat
cgcctgccaagcctgccctactcgtattcagcccttgagccctatatttcaaaagaaatt
atgtttcttcatcatacaaaacatcaccaaagctatgtcgacggtttgaacagagctgaa
aaagaactgcagaaagcgaggcaaaccaaacagtttgacctcgttaaccattgggaaaga
gagctcgccttccacggagccgggcactatttgcatacgatattttggtacgcgatgcac
ccaaaaggaaaaagacggccgacaggcgaattgctggagatgatcaaccgttcattcggc
agctattcggcctttaaagaacacttttccgaagcggcgaaaaaagtggaaggcgtcggc
tgggcgatcctcgtctgggcgccgcgttcgcaccgcttggaaattctgatcgcagaaaaa
catcagctgatgagccaatgggatgtgatccccctgctcccgctcgatgtatgggagcac
gcatattaccttcaatataaaaatgaaaaggcaaaatacgtcgataattggtggaatgtc
gttgactggagagagcctgaaaggcgatttgcgtcagcaaagcgcgttttatgggagccg
ttctga

DBGET integrated database retrieval system