KEGG   Bacillus licheniformis ATCC 14580: BL00724Help
Entry
BL00724           CDS       T00197                                 

Definition
carbohydrate esterase family 8 protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bli00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bli00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3337505..3338458)
Genome map
AA seq 317 aa AA seqDB search
MVNREAAAIRLTVSKDGDGEFQTVQEAIDALPEYSREQKVIFIKKGVYKEVVHIPATKPF
VKLIGENRYETVITYDNYAGKEKEGGGKYGTTGSSSVFIYADHVEAENLTFENSFDRTKV
DTTDTQAVAVYAKGNRMTFKYVRFIGRQDTLFVNDGTQYFYQCYIEGDVDFIFGGARAVF
EECQIHSADRGSATNNGYVTAASTHIAKPFGLLITNCRVTSDAADGTVYLGRPWHPGGDP
DAIASVLYHRCDLGAHIKPEGWTDMSGFSAADARLYEYGNTGPGAISHEARRQLADHEAE
KWTIENVLDGWNPKVES
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggttaatcgggaggcagctgctatacggctgacggtttcgaaggatggagacggcgaa
tttcaaaccgttcaagaggcgatcgatgctttgcctgagtacagtcgggaacagaaagtg
atattcattaaaaaaggagtttacaaagaagtcgttcatattccggctacaaagccgttt
gtgaagctgatcggcgaaaatcgttacgagactgtgattacgtatgacaactatgccgga
aaagaaaaggaaggaggagggaaatacggcacgaccggaagttcaagcgtgtttatttat
gcggatcatgttgaagccgaaaatttgacgtttgaaaactcgttcgaccgcacgaaagtc
gacacgaccgatacgcaagcggtggcggtttatgcgaaaggaaacaggatgacgttcaaa
tatgtcaggtttataggcagacaagatacactgtttgtcaatgacggtacacaatatttt
tatcaatgctatatagaaggcgatgtcgatttcattttcggaggagcaagagctgtgttt
gaagagtgccagatccatagcgctgaccgcgggtccgctacaaacaacggttatgtgaca
gctgcgagcacgcatatcgcaaagccgttcggtttattgataacaaactgcagagtgaca
agcgatgccgcagatggaacggtatacctcgggcgcccatggcatccgggaggagacccc
gacgccatcgccagtgtgctatatcaccgctgcgatttaggcgcacacatcaagcctgaa
ggatggacggatatgtcgggcttttctgcggccgatgccagattgtacgaatacgggaat
acgggtccgggtgcgatttcgcatgaggcccgaaggcagcttgccgatcatgaggctgag
aaatggacaattgaaaacgtattggacggctggaatcctaaagttgaatcatag

DBGET integrated database retrieval system