KEGG   Bacillus licheniformis ATCC 14580: BL00861Help
Entry
BL00861           CDS       T00197                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BL00861 (sul)
Enzymes [BR:bli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BL00861 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90572..91429
Genome map
AA seq 285 aa AA seqDB search
MALQTAVRSKQLIAKQYTLSYEDKTLIMGILNVTPDSFSDGGKYNSIDRAVIHAKQMIED
GAHILDIGGESTRPGAEKVSLDEELSRVIPVIEKLVQEIDVPISVDTYKAQVADEAIKAG
AAIINDVWGAKADPDMARVAAAHNVPIILMHNREERNYKDLIPDMLSDLMECVSIAKSAG
VQDHHIVLDPGIGFAKTYHDNLAVMNQLEKFSEPGYPVLLGTSRKKFIGRVLDLPPEERA
EGTGATVCLGIQKGCDIVRVHDVKQISRMAKMMDAMIDKGGVYHR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcaaacagcggtgcgttcaaagcaactgatcgcaaagcaatacacgttgtct
tatgaagataaaacattgatcatgggaattttaaatgtgacgcccgattctttttcagac
ggcggaaaatataacagcatcgatcgcgccgtcattcatgcaaaacaaatgatcgaagac
ggcgcccatatccttgatatcggaggagaatcgacgaggccgggggcggaaaaggtttct
cttgatgaagagctgtcaagagtcatacctgtaattgaaaaacttgttcaggaaatcgac
gtcccgatttccgttgacacttataaagcgcaagtggcagatgaagccattaaggccggt
gcagccatcatcaatgatgtctggggagcaaaagcagatcctgacatggcccgagttgcg
gccgctcataatgtgccgattatcttgatgcataaccgcgaggaacggaattataaggat
ttgatcccggacatgctgtctgatttgatggaatgtgtgagcattgcaaaatcagcaggc
gttcaggatcatcacatcgtacttgatcccggcatcggctttgccaaaacgtatcatgac
aatttggcggtcatgaatcagctcgagaagttcagcgaaccgggatacccggttttattg
gggacgtcacgaaaaaaatttatcggccgagtcctggatctgccgcctgaagaaagagcg
gaaggcacgggggcgacagtatgcctcggtattcaaaaggggtgcgatatcgtcagggtg
catgacgtcaagcaaatctccaggatggcaaaaatgatggatgccatgattgataaagga
ggcgtttatcatcgataa

DBGET integrated database retrieval system