KEGG   Bacillus licheniformis ATCC 14580: BL01111Help
Entry
BL01111           CDS       T00197                                 

Gene name
apr
Definition
hypothetical protein
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bli  Bacillus licheniformis ATCC 14580
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1109115..1110254)
Genome map
AA seq 379 aa AA seqDB search
MMRKKSFWLGMLTALMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKE
SGGKVDKQFRIINAAKAKLDKEALEEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADK
VQAQGYKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALD
NTTGVLGVAPNVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMK
QAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAEL
EVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATY
LGSSFYYGKGLINVEAAAQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggaaaaagagtttttggcttgggatgctgacggccttaatgctcgtgttcacg
atggccttcagcgattccgcgtctgctgctcagccggcgaaaaatgttgaaaaggattat
attgtcggatttaagtcgggagtgaaaaccgcatccgtcaaaaaggacatcatcaaagag
agcggcggaaaagtggacaagcagtttagaatcatcaacgcggcaaaagcgaagctagac
aaagaagcgcttgaggaagtcaaaaatgatccggatgtcgcttatgtggaagaggatcac
gtagctcatgctttggcgcaaaccgttccttacggcattcctctcattaaagcggacaaa
gtgcaggctcaaggctacaagggagcgaacgtaaaagtcgccgtcctggatacaggaatc
caagcttctcatccggacttgaacgtagtcggcggagcaagcttcgtagctggcgaagct
tataacaccgacggcaacggacacggcacgcatgttgccggtacagtagctgcgcttgac
aatacaacgggtgtattaggcgttgcgccgaacgtatccttgtacgcggttaaagtgctg
aattcaagcggaagcggatcttacagcggcattgtaagcggaatcgagtgggcgacgaca
aacggcatggatgttatcaacatgagccttggaggaccatcaggctcaacagcgatgaaa
caggcggttgacaatgcatatgcaagaggggttgtcgttgtggcggctgctgggaacagc
ggatcttcaggaaacacgaatacaatcggctatcctgcgaaatacgactctgtcatcgca
gttggcgcggtagactctaacagcaacagagcttcattttccagcgtcggagcagagctt
gaagtcatggctcctggcgcaggcgtgtacagcacttacccaaccagcacttatgcaaca
ttgaacggaacgtcaatggcttctcctcatgtagcgggagcagcagctttgatcttgtca
aaacatccgaacctttcagcttcacaagtccgcaaccgtctctccagtacggcgacttat
ttgggaagctccttctactatggaaaaggtctgatcaatgtcgaagctgccgctcaataa

DBGET integrated database retrieval system