KEGG   Bacillus licheniformis ATCC 14580: BL01144Help
Entry
BL01144           CDS       T00197                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BL01144 (ruvA)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BL01144 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2791303..2791908)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKKNSKETIYTYHYVREDTNALYGF
STREEKMLFTKMLNVTGIGPKGALAILASGDPGAVIEAIENEDEAFLVKFPGVGKKTARQ
IILDLKGKLADAVPEIAADLFNHEEREQIHEAATALEEALEALRALGYSDREIKKVQPHL
KKEEALSTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaattcgtaaaagggacgattgattatgtatcgccccaatatattgtcattgaa
aacggcgggatcggctatcagatcttcacgccaaatccgtttatttataagaaaaacagc
aaagaaacaatctatacataccattatgtaagagaagacacgaatgcgctgtacggcttt
tcgacaagggaagaaaaaatgctgtttacgaaaatgctgaatgttacggggatcggccca
aaaggagcgcttgcgatcctcgcttccggcgatccgggagcggtgattgaagcgatcgag
aatgaggacgaagcatttctcgtcaaatttcccggcgtaggcaaaaaaacggcaaggcag
atcatccttgacctgaaagggaagcttgcggatgccgttcctgaaatcgctgccgatctg
tttaaccatgaagagcgggagcaaattcatgaagcggcaacggctcttgaggaagcgctt
gaagcattgagggcgctcggctattccgatcgggaaattaaaaaagtccagcctcatttg
aaaaaggaagaggcgctttcgacagatcaatacgttaaaaaagcattgcaaaaattgtta
aagtaa

DBGET integrated database retrieval system