KEGG   Bacillus licheniformis ATCC 14580: BL01230Help
Entry
BL01230           CDS       T00197                                 

Gene name
celC
Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BL01230 (celC)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BL01230 (celC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1841611..1843293
Genome map
AA seq 560 aa AA seqDB search
MREKWLALCLKSIILFVLIMGTVLLSAVPKASGTSGPAKQEKQSIITPADLLENMSPGWN
LGNTLDAVPTEGSWNNPPVREHTFDDIRDAGFKSVRIPVTWDSHIGSAPEYPIDTDWMNR
VEEVTDWALEREFYVVLNIHHDSWLWISRMGNSQQETLDKLGKVWKQIAERFKNKSERLL
FEIVNEPTGMSAYQMNLLNREMLNIIRSTGGKNGQRLVIVGGLEDNKDELLHSFEPPDDD
RIVLTYHYYSPWDYVSNWWGRTTWGSAAEISEMEEDIKPVYEKFVREGYPVIIGEYGTLG
ANEKHSKWLYHDTFVRLAHKYQMVPMWWDNGNDQFDRAERQWRDPVVKEIVIQAGRGVPN
AIIKPADLFIKKGQSISDQTVDIQLNGNVLTGIYQKSEPLKEGSDYTVDNAGKTVSIKAS
CLAKLLNGAGQPGVKAQLTFTFHKGASQVMDIILYDDPKLEKSEFTISQSAISGDLKIPA
SLNGTKLATVKGVVDSTGRPVLEEVWSWTPYLNYDEDFYEKDGDLYLKERVLKYLKSDST
FTFELWPKGVEAVVKVKITP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaaaaatggttagccttatgtttaaagtcgatcattctgttcgttttgatcatg
ggaaccgttcttttatccgcagttccgaaagcttcgggaacaagcgggccagcaaagcaa
gaaaagcagagcatcatcaccccggctgatcttttggaaaacatgagccctggatggaac
cttggcaacacgctggatgctgttccgacagaaggctcttggaacaatccgccggttcgc
gagcatacttttgatgatattcgcgatgcggggtttaaaagcgtccggattccggtgaca
tgggattcccacatcggcagcgctccagagtatccgatcgataccgattggatgaaccgg
gtagaagaagtgacagattgggctttggaaagagagttttacgtcgtgttaaatattcac
cacgattcttggctatggatcagccggatgggaaacagccagcaggagacattagataag
ctggggaaagtctggaagcagattgccgagcgcttcaaaaacaaaagtgaacgcctcctg
tttgaaattgtcaatgagccgaccggaatgagcgcatatcaaatgaatctgcttaaccga
gagatgctgaacatcatccgttcgaccggcggcaaaaacggccagcggctcgtaatcgtc
ggggggcttgaagataacaaagatgaattgcttcattcatttgaaccgcctgatgatgac
cggattgtcctcacatatcactactattctccttgggattacgtatcaaactggtggggc
cggacgacttggggatcggcagccgaaatctccgagatggaggaggatatcaaaccggtt
tatgaaaaatttgtaagggaaggatacccggttatcatcggtgaatacggtaccctcggc
gccaatgaaaagcattcaaaatggctctatcatgatacgtttgtccgccttgcccacaaa
tatcaaatggtcccgatgtggtgggacaacgggaatgaccagtttgaccgggctgagaga
cagtggcgtgatcctgttgttaaagagattgtcattcaggcgggacgcggcgttcccaat
gcgatcatcaaaccggcagatctttttatcaaaaaaggtcaaagcatcagcgatcagacg
gtggacattcagctgaacggcaatgtgctgactggcatttatcagaaatctgaaccatta
aaggaaggcagtgattatacagttgacaatgccggaaaaacggtctctattaaggcatcc
tgcttggcaaagctgctgaacggggcggggcagcctggggtaaaagcgcagctcactttt
acgtttcataaaggagccagccaggttatggatatcattctttatgatgacccgaagctt
gaaaaaagcgaattcaccatcagtcaatcggcaatcagcggtgatctcaaaatcccggcg
tcactgaacggaacgaagctggccacggttaaaggagtcgtcgattctacaggaaggccg
gttcttgaagaagtatggtcatggacgccctacttgaactatgacgaagatttttacgaa
aaagacggggatttgtatttgaaagagcgggttttaaagtatttgaaaagcgattccacc
tttacatttgaactgtggccgaaaggcgtggaggcggtcgtgaaggtgaaaatcacgcct
tga

DBGET integrated database retrieval system