KEGG   Bacillus licheniformis ATCC 14580: BL01237Help
Entry
BL01237           CDS       T00197                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bli00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828300..1829451
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVIKAHDDKFRLTAMTFGKNAEKAAEIIETFKPKYVGVGDEH
TYETLKQHSFSYTFKTGIGEEALIEAAVIPEADIVVNALVGSVGLLPTLKAMEHKKTIAL
ANKETLVTAGHIVKEHAQKYDVPLLPVDSEHSAIFQALQGENPKHIKRLIVTASGGSFRD
RTRRELEGVTVEEALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDLPYDQIDVLLHK
ESIIHSMVEFHDRSVIAQLGTPDMRVPIQYALSHPERLPFNEAKSLDLWEVGQLNFAQAD
FERFRCLQFAYESGKIGGTMPTVLNAANEEAVAAFLSGRISFLGIEDIIEKALERHQVIA
KPSLQEIREVDKDARKFVQTLLT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaacatatgtctattgggagcgacaggctccataggagaacagacgcttgatgtc
atcaaagcgcatgacgataagtttcggctgaccgccatgactttcggcaaaaacgccgaa
aaagcggcagaaatcattgaaacctttaaaccgaagtatgtaggcgtcggggatgagcat
acatatgaaacattaaaacagcattctttctcctacacctttaaaacagggatcggggag
gaagctttaatcgaagcggccgttatcccggaagcggatatcgtcgtcaatgctctcgtc
ggcagcgtcggtcttcttccgactttaaaggcgatggagcataaaaaaacaattgcgctt
gcaaataaggaaactctcgtgacagccggtcatatagtgaaagaacacgcccaaaaatac
gatgtcccgctcctgcccgtcgacagcgaacattccgcgattttccaggcccttcagggg
gaaaatccgaagcatatcaaacggctgatcgtcacggcttcaggcggcagcttcagggac
agaacaaggcgggaacttgaaggcgtcacagtggaagaagccctcaatcatccaaattgg
tcgatgggtgcaaaaatcacgatcgattcggctacaatgatgaataaaggactcgaggtt
attgaagcccactggctgtttgatctgccctatgaccagatcgatgtcctccttcacaaa
gaaagcattattcattcaatggttgaattccacgaccgcagcgtcatcgcccagcttggc
acacctgatatgagagtgccgattcaatatgcgctcagccatccggaacgcctgccgttt
aatgaagcaaaatccctcgatctctgggaagtcggacagctgaattttgcccaagctgat
tttgaaaggttccgctgcttacaattcgcttatgaatcaggtaaaataggcggtacaatg
ccgactgttttaaacgcggccaacgaggaagccgttgcggcatttctttcgggcaggatt
tcctttcttggaatagaagacatcattgaaaaggctttggaacgccatcaggtgatcgca
aagccgagccttcaagagatccgtgaagtggacaaagacgccagaaagtttgtccaaaca
ttactcacataa

DBGET integrated database retrieval system