KEGG   Bacillus licheniformis ATCC 14580: BL01342Help
Entry
BL01342           CDS       T00197                                 

Gene name
asnO
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BL01342 (asnO)
Enzymes [BR:bli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BL01342 (asnO)
Peptidases [BR:bli01002]
 Cysteine Peptidases
  Family C44
   BL01342 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181197..1183038
Genome map
AA seq 613 aa AA seqDB search
MCGITGWVDFKKPLVREQSIMEKMTDTLSKRGPDDTNIWGKRHVLFGHKRLAVVDLEGGR
QPMTRTHQGYDYTICYNGELYNTEDLRKELRRRGHQFKSHSDTEVLLHSYMEWKEECIDR
LNGIFAFAVWDEKRDLLFAARDRLGVKPFFYTEQGSSFLFGSEIKAILAHPEVKAKVDRS
GLAEIFGLGPSRSPGSGVFKGVKEIRPGHAMIFSKDGLTVWRYWNVKSEKHTDSFDETVE
NVRSLFQDAVTRQLVSDVPVCTFLSGGVDSSAITATAAKHFEREGKAPLHTFSIDYEDNE
QYFTSSSFQPNADGPWIKKMSDAFGTVHHNCVISQEELAAYLEEAVLVRDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHSAEDVKGFPWMRSMEERIGLLQDGWQKK
LNLSEYVKAKYEETVKETPLLEGETGAEKRRRELFYLNMLWFMTTLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWDVKMHGSREKGIFRKALEGILPDEVLYRKKSPYPKTHHPAY
TKAVIRWLESLLEQKDSALYAFLEKKKLERLIETEGASFQVPWYGQLMKGPQLIAHLAQI
HTWFESYRIDIEE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaataacggggtgggtcgattttaagaagccgcttgtccgagagcagtcaatc
atggagaagatgactgatacgctttcgaaaagaggacctgatgatacgaatatttgggga
aagcgccatgttttattcggacataaacgcttggcagttgtggatctggaaggcggcaga
cagccgatgacccgcacacatcaaggatatgattatacgatttgctataatggcgagctc
tataatacggaggatttgcgaaaagagcttaggcggcgggggcatcaattcaagagccac
tcagatacagaggttttgcttcattcatacatggaatggaaagaggaatgcatcgacagg
ctgaacggaatttttgcatttgcggtatgggatgaaaagcgggatcttctttttgcggca
cgcgaccggcttggtgttaaaccgttcttttacaccgaacagggctcatcatttttgttc
ggatctgaaatcaaagccatcctcgctcatcctgaagtgaaagcaaaggtagaccgttca
gggctggcagaaattttcggcctcggcccgtcacgatcgccggggagcggtgtttttaaa
ggagtaaaggagatccgcccggggcatgcgatgattttctcaaaagacggtttaacggtt
tggcgctactggaatgtgaaaagcgagaagcatacggacagctttgacgaaacggtggaa
aatgtgcggtcgctgtttcaggacgccgttacaaggcagcttgtgtctgatgtgccggta
tgtacgtttttatctggaggggtcgattcgagcgccattaccgcaacggccgccaagcat
ttcgagagagaagggaaggcgccccttcatacgttttcgatcgattatgaagacaatgag
caatattttacgtcaagctcatttcagccaaacgccgacggcccgtggattaaaaaaatg
tccgatgcattcggaacggttcatcacaattgcgtgatatcccaggaggagctggctgcc
tatttggaagaagccgtactggttcgggatttgccggggatggctgatgtcgattcttcc
ctgctatggttctgccgcgagattaaaaaagactttgtcgtgagcctttcaggggaatgc
gcggacgaaattttcggcggctatccttggttccattcggcagaagatgtgaaaggtttc
ccatggatgagatcaatggaagaacggatcggacttctgcaggacggctggcagaaaaag
ctgaacctcagcgaatatgtgaaggcaaaatatgaggaaacagttaaagaaacaccgctg
ctggaaggagaaacgggtgcggagaaacgaaggagagagctgttttacttaaatatgctc
tggtttatgacaacgctcttggatcgaaaagacagaatgagcatgggtgcgagcctcgag
gtcagggttccgtttgcagatcacaggcttgtcgagtatgtctggaatattccatgggat
gtcaaaatgcatggcagccgtgaaaaaggcatcttccgcaaggcgctggaaggcattttg
cctgatgaagtgctgtaccgcaaaaaaagcccatatccgaaaacgcaccacccggcctat
acgaaagccgtgatacgctggctggagtcattgctggagcaaaaagactcggcgctctat
gctttcttagaaaagaaaaaactggagcggctgattgagacggaaggtgcatcatttcaa
gttccgtggtacggacaattgatgaagggaccgcagctgatcgcccaccttgcccaaatc
catacttggtttgaaagttatcgaattgatatcgaggaataa

DBGET integrated database retrieval system