KEGG   Bacillus licheniformis ATCC 14580: BL01419Help
Entry
BL01419           CDS       T00197                                 

Gene name
glgB
Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BL01419 (glgB)
Enzymes [BR:bli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BL01419 (glgB)
Exosome [BR:bli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BL01419 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3113742..3115625)
Genome map
AA seq 627 aa AA seqDB search
MAGVSASDIKAHLFHEGRLYESYRFFGAHQTEQDGRQGFRFCVWAPHAKEVRIAGTFNGW
SGVLHRMEKRHQEGIWELFIPGIGEGELYKYEMITAANETKLKADPYAFFSEVRPKTASV
TYQLAGYQWGDRKWQKKKQQKAVYEKPISIYELHIGSWKKKADGRFFTYRELSETVIPYV
KEHGFTHIELMPLTEHPFDRSWGYQTTGYYSPTSRYGEPHDLMYFIDQCHQHEIGVIMDW
VSGHFCKDDHGLYLFDGMPLYEYKHEHDRENWEWGTANFDLGKREVHSFLISNALYWIEM
YHIDGFRVDAVANLLYWPNRPQPEANGFAIEFIQTLNEQVFAKDPHFLMIAEDSTDWPLV
THPTYEGGLGFNYKWNMGWMNDVLTYMEASPEQRKHLHHLVSFSLMYAYSENYILPFSHD
EVVYRKKSLLHKMPGDYWQKFAQYRLLISYFMMHPGKKLLFMGGEFAQFDEWKDEEELDW
FLDDFDMHRKARMFTKEALHLYKKSRILYENDHRQQGFEWIDVNNAEQSIVSFIRYGKQP
GEALIIVCNFTPSVYHEYRVGVPFQTEYIEVLNSDDAKYGGSHQINPKRLQARKGVLHGK
PYSISMTVPPLGAAVFRAVKKRGAKKG
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgtgagtgcctcggatattaaagcgcatctctttcatgaaggtcggctttat
gaaagctacaggttcttcggcgctcatcagacggaacaggacggccgccaaggcttccgt
ttctgtgtttgggccccgcatgcgaaggaggttcgaatcgccggaacgtttaacggctgg
tccggtgtcctgcaccgaatggaaaagcgtcatcaggaaggcatatgggaactgtttatc
cccggtattggagaaggggagctgtataaatatgaaatgattacagccgcaaatgaaacg
aaattgaaggctgatccttatgcttttttttctgaagtgaggccgaaaacggcatcggtc
acttatcaattggccggataccaatggggcgaccggaagtggcaaaagaaaaagcagcaa
aaagccgtgtatgaaaaaccgatttccatctacgagcttcatatcggttcgtggaaaaag
aaagcggatggacgttttttcacataccgggaactgagcgaaacggtcattccttacgtc
aaagaacacggattcacacatatcgagctgatgccgctgacagagcacccgtttgaccgt
tcatggggctaccagacaacagggtactacagtccgacgagcagatatggcgaaccgcat
gacttgatgtatttcatcgaccagtgccatcagcatgagatcggcgtcattatggattgg
gtttccggccatttttgcaaagatgaccacggcttgtatttgtttgacggtatgcctctg
tatgaatataaacacgagcatgacagggaaaattgggaatgggggaccgccaattttgac
ctcggaaaacgagaagttcacagttttttaatctcgaatgcgttgtattggatcgagatg
tatcatatagatggatttcgagtcgatgcggttgcgaacctcctgtattggccaaaccgt
cctcagcctgaagcgaacggctttgcgatcgaatttattcaaacgttaaatgaacaggtt
tttgcaaaagatccccactttttgatgattgcagaggactccacagactggccgcttgtg
acgcatccgacctatgaaggcggtctcgggtttaattataagtggaatatgggttggatg
aacgatgtattaacctatatggaagcttccccagaacaaagaaaacacctgcatcatctt
gtttcattctccttaatgtatgcctactcagaaaattacatcctgccgttctcccacgat
gaagtggtgtaccgcaaaaagtctctgcttcataagatgcccggcgattattggcagaaa
ttcgcccagtaccgcctgctgatcagttattttatgatgcacccgggaaaaaagcttctt
tttatgggcggtgagtttgctcaatttgatgaatggaaagacgaagaagagctcgattgg
tttttggacgattttgacatgcaccgcaaagcccgaatgtttacaaaggaggctctacac
ctctacaaaaaaagccgtatcctgtatgaaaatgatcatcggcagcaaggattcgagtgg
attgacgttaacaatgcggaacagtcgattgtatcgtttatccgctatggaaaacagccc
ggtgaagcgctgattatcgtctgcaatttcacgccttccgtctatcacgaatatcgggtc
ggcgtcccttttcaaaccgaatatatcgaagtgcttaacagcgatgatgcaaaatacgga
ggttcacaccaaatcaacccaaaacgccttcaggcaagaaaaggcgttctgcacggcaaa
ccatacagcatcagcatgacagtccctccgctgggagctgcggttttcagagcagtcaaa
aagagaggagcgaaaaagggatga

DBGET integrated database retrieval system