KEGG   Bacillus licheniformis ATCC 14580: BL01581Help
Entry
BL01581           CDS       T00197                                 

Gene name
glcK
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00010  Glycolysis / Gluconeogenesis
bli00052  Galactose metabolism
bli00500  Starch and sucrose metabolism
bli00520  Amino sugar and nucleotide sugar metabolism
bli00521  Streptomycin biosynthesis
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
Module
bli_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bli_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL01581 (glcK)
   00052 Galactose metabolism
    BL01581 (glcK)
   00500 Starch and sucrose metabolism
    BL01581 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BL01581 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BL01581 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BL01581 (glcK)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BL01581 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N DUF1464
Motif
Other DBs
NCBI-ProteinID: AAU24173
UniProt: Q65HD1
Position
complement(2567245..2568219)
Genome map
AA seq 324 aa AA seqDB search
MNDSWLVGVDLGGTTVKLAFVSAYGEILHKWEIPTDKSGKTVTVSIAKAIDSKLNELGKP
KHILKWIGMGAPGPVNTETGIVYKTTNMGWENYPLKDHLEAETGIAAVIENDANIAALGE
MWKGAGDGAKDLILVTLGTGVGGGIIVNGEIVRGQNGAGGEIGHICSVPEGGAPCNCGKS
GCIETIASATGIVRIAKEKIESDHRDTSLRECLDITARDIFEAARKNDPVAGEVVDYVAG
HLGMVLANLASSLNPSKIVIGGGVSKAGEILRSKVEQSFKRFVFPRAGEAAEIVIASLGN
DAGVIGGAWIAKNQWLKSQAQPVL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacagctggctggtcggggtcgaccttggaggaacaacagtaaaactcgctttt
gtaagcgcttatggcgaaatcctgcacaagtgggaaatcccgaccgataaatcagggaaa
acggttacggtaagcatcgcgaaagccatcgacagcaaattgaacgagctcggcaaaccg
aagcacatcttaaaatggatcggcatgggcgctcccggacccgtcaatacggagaccggc
atcgtttataaaacgacgaatatgggctgggaaaactacccgttgaaagaccatctggaa
gcagagacagggatagctgcggtcattgaaaatgacgcgaacatcgcagctctcggcgaa
atgtggaagggagcgggagacggcgcgaaggatttgattcttgttacattgggaacgggc
gttggaggcggcattattgtaaacggggaaatcgtccgcgggcaaaacggagcaggcggt
gaaatcggccacatctgttctgttccagaaggcggagcgccgtgcaactgcggaaaaagc
ggctgtatcgaaacgatcgcttcggctaccggcatcgtcaggattgccaaagaaaaaata
gaatctgaccatcgagatacaagcttgcgtgaatgtctggacataacggcgcgcgacatc
tttgaagccgccagaaaaaacgatcctgttgccggcgaagtcgtcgattatgtggcgggt
catttaggaatggtcctcgctaacttggcgagctcgcttaatccttcaaagatcgtaatc
ggcggaggcgtgtcaaaagcgggagaaatcctgcgctccaaagttgaacaatctttcaag
cgctttgtattcccgcgggccggcgaggcggctgagatcgtaatcgcttcacttggaaac
gacgcaggcgtgatcggcggtgcatggatcgcaaaaaaccaatggctgaaaagccaggcg
cagcctgttttataa

DBGET integrated database retrieval system