KEGG   Bacillus licheniformis ATCC 14580: BL01581Help
Entry
BL01581           CDS       T00197                                 

Gene name
glcK
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BL01581 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL01581 (glcK)
   00052 Galactose metabolism
    BL01581 (glcK)
   00500 Starch and sucrose metabolism
    BL01581 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BL01581 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BL01581 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BL01581 (glcK)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BL01581 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2567245..2568219)
Genome map
AA seq 324 aa AA seqDB search
MNDSWLVGVDLGGTTVKLAFVSAYGEILHKWEIPTDKSGKTVTVSIAKAIDSKLNELGKP
KHILKWIGMGAPGPVNTETGIVYKTTNMGWENYPLKDHLEAETGIAAVIENDANIAALGE
MWKGAGDGAKDLILVTLGTGVGGGIIVNGEIVRGQNGAGGEIGHICSVPEGGAPCNCGKS
GCIETIASATGIVRIAKEKIESDHRDTSLRECLDITARDIFEAARKNDPVAGEVVDYVAG
HLGMVLANLASSLNPSKIVIGGGVSKAGEILRSKVEQSFKRFVFPRAGEAAEIVIASLGN
DAGVIGGAWIAKNQWLKSQAQPVL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacagctggctggtcggggtcgaccttggaggaacaacagtaaaactcgctttt
gtaagcgcttatggcgaaatcctgcacaagtgggaaatcccgaccgataaatcagggaaa
acggttacggtaagcatcgcgaaagccatcgacagcaaattgaacgagctcggcaaaccg
aagcacatcttaaaatggatcggcatgggcgctcccggacccgtcaatacggagaccggc
atcgtttataaaacgacgaatatgggctgggaaaactacccgttgaaagaccatctggaa
gcagagacagggatagctgcggtcattgaaaatgacgcgaacatcgcagctctcggcgaa
atgtggaagggagcgggagacggcgcgaaggatttgattcttgttacattgggaacgggc
gttggaggcggcattattgtaaacggggaaatcgtccgcgggcaaaacggagcaggcggt
gaaatcggccacatctgttctgttccagaaggcggagcgccgtgcaactgcggaaaaagc
ggctgtatcgaaacgatcgcttcggctaccggcatcgtcaggattgccaaagaaaaaata
gaatctgaccatcgagatacaagcttgcgtgaatgtctggacataacggcgcgcgacatc
tttgaagccgccagaaaaaacgatcctgttgccggcgaagtcgtcgattatgtggcgggt
catttaggaatggtcctcgctaacttggcgagctcgcttaatccttcaaagatcgtaatc
ggcggaggcgtgtcaaaagcgggagaaatcctgcgctccaaagttgaacaatctttcaag
cgctttgtattcccgcgggccggcgaggcggctgagatcgtaatcgcttcacttggaaac
gacgcaggcgtgatcggcggtgcatggatcgcaaaaaaccaatggctgaaaagccaggcg
cagcctgttttataa

DBGET integrated database retrieval system