KEGG   Bacillus licheniformis ATCC 14580: BL01643Help
Entry
BL01643           CDS       T00197                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bli00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bli00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bli02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255479..257230
Genome map
AA seq 583 aa AA seqDB search
MTHEGPLEEWMKKLSEESLKDNTFDRRRFIQGAGKIAGLSLGLAIAQSMGAMEVNAAPRF
SEYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPNEAVSVKWELAEDERFRRVVKRGT
EKATPHLAHSVHAEVSGLKPNHVYYYRFKCGNQLSPVGKTKTLPAPGADVAKFTFAFASC
QQYEHGYYTAYQHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHSGPEIMSLLDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANVIPEKGQSVEAFIKRRAAAYQAYYE
HMPLRRQSLPNGPDMQLYRNFSYGNLADISVLDTRQYRDDQANGDGNKPPSDESNDPKRT
LLGAEQEAWLFDNLSRSEAHWNIIAQQIFFAQWNFGTSAAPIYSMDSWDGYPAQRKRVID
FIKSQKLNNIVVLTGDVHASWANNLLVDFDNPKSDIFGVEFVGTSITSGGNGADKRADTD
KILSNNPHIKFFNDYRGYVRCTVTPEEWRTDYRVVPYVTEPGAAVSTRASYVYHKDYTGL
KRTASNIVPGGVKKSNEVEEDRFLAHTRAHQKQVKQKEKKVTQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacacatgaaggaccgctggaggaatggatgaaaaaactgagcgaggaaagcctcaag
gacaatacgtttgaccgccgccgctttattcaaggggccggcaaaatagccgggctttcg
ctcggacttgcgatcgcgcaatcgatgggggcaatggaagtcaatgcagcaccgaggttc
tccgaatatccgtttacacttggcgttgcatcgggagatccgctttctgacagcgtcgta
ttgtggacaaggctggcgcccgatccgctaaacgggggcgggatgccaaatgaagctgta
tccgtgaaatgggagctcgcagaagacgaacgcttccgccgtgtcgtcaaacggggaacc
gaaaaagcaacacctcaccttgcacattcggtacatgccgaggtatccgggctgaaaccg
aatcatgtatactattaccgctttaaatgcggcaaccagctgagtcctgtcggcaagaca
aagacgcttccggcgcccggggcagatgttgctaaattcacattcgcttttgcttcatgc
cagcagtacgaacacggctattataccgcctatcagcatatggcaaaggaaaagctcgat
cttgtttttcatctcggcgactatatttatgagtacggtccgaatgaatatgtttcgaaa
acaggaaatgtcagaacacacagcggtcctgaaatcatgtcactgctcgattaccgaaac
cgtcatgcccaataccgttcagatgcaaacctgaaagctgcgcatgccgccttcccgtgg
gttgtcacatgggacgaccatgaagtggagaacaactatgcgaatgtcatcccggaaaaa
ggccagtcagttgaagcgtttattaaacggcgcgccgccgcataccaagcttattacgag
catatgccgctccgccgccaatccttgccgaacggtcctgatatgcaattgtaccggaat
ttttcctacggcaatttagctgacattagcgtgctggatacccgtcagtatcgcgatgac
caggctaacggcgatggcaataagccgccttctgatgaatcgaatgatccgaagcggacg
ctgcttggagcggagcaggaggcttggctgtttgacaatctgagtcgctccgaggcgcac
tggaacattatcgcacagcagattttctttgcgcagtggaactttgggacaagcgcggcg
ccgatttacagcatggattcgtgggacggatatcccgctcagcgcaagcgggtgatcgac
ttcatcaaatctcaaaaactgaacaacatcgtcgtccttaccggtgatgtgcatgccagc
tgggcaaataatctgctcgttgattttgacaatccgaaatcggacatctttggcgtggag
ttcgtcgggacgtcgattacatcgggaggaaacggcgctgataaaagagcggatacggat
aagattttatcgaacaatcctcatataaagtttttcaatgattaccgcggctatgtgcgc
tgtacggtcaccccggaagaatggcggacagattaccgcgtcgtcccgtatgtgacagag
ccgggtgcggcggtttcgacaagagcttcctatgtttatcataaagactacacagggctg
aaacggaccgcttccaacattgtgcctggaggcgtgaagaagtcaaacgaagtagaagaa
gaccgtttcctcgcacatacaagggcccatcagaagcaagtgaagcaaaaggagaaaaaa
gtaacccagtaa

DBGET integrated database retrieval system