KEGG   Bacillus licheniformis ATCC 14580: BL01718Help
Entry
BL01718           CDS       T00197                                 

Gene name
yckE
Definition
glycoside hydrolase family 1 YckE
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL01718 (yckE)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BL01718 (yckE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363638..365074
Genome map
AA seq 478 aa AA seqDB search
MIHQRLRPFPDHFLWGSASAAYQIEGAWNEDGKGLSVWDVFTKIPGKTFKGSNGDIAVDH
YHRFKEDVALMAEMGLKAYRFSVSWPRIFPQGRGEANESGLRFYDDLINELLAHDIEPVL
TLYHWDLPQALMDEYGGFESRRIIEDFNAYCVTLYKRYGGRVKYWVSLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIDSFRRYVPDGKIGPSFAYSPAYPLSSRPDDI
LAFENAEEFTNYWWLDMYCRGTYPDIPLKYLKEKGWAPTIEDGDMELLAKGKPDFVGVNY
YQTITYEMNPLDGVSEGKMNTTGQKGSNQETGMPGLYKTKRNPHLETSNWDWAIDPIGLR
IGLRRISSRYGLPLFITENGLGEFDKVENDGTIHDDYRIAYLRAHLEQCRQALNDGVDLI
GYCSWSFTDLLSWLNGYQKRYGFVYINRDEENVKDLKRIKKDSFYWYQNVIQTNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgattcatcagcgactacgcccatttccagatcatttcctatggggatcagcatctgca
gcctaccagatcgaaggagcctggaatgaagacggcaaggggctttcggtttgggatgtg
ttcacaaagattcccggaaaaacgtttaaaggaagcaatggagacattgcggtcgaccat
taccaccgttttaaagaagatgttgctttaatggctgagatggggttaaaagcataccgc
ttttcagtcagctggccgaggatttttccgcagggcaggggagaagccaatgaatcgggt
ttgagattttacgatgacttgattaatgagctccttgctcatgatattgaacctgttttg
acgctttatcattgggatcttccccaggctttaatggatgaatacggcggctttgaatcc
agaagaattatagaggatttcaatgcgtattgcgttacgctctataagcggtatggaggc
agggttaaatattgggtgtcccttaacgagcaaaattacaactttaatcacggctttatc
acagcgatgcatcccccgggtgtgaaggatagaaaacgcttctatgaggctaaccatatt
gcatttctagcgaatgcaaaggcaatcgattcttttcgccggtatgttcccgatggaaaa
atcggaccgagttttgcttattcgcctgcatatcccctctccagccgtccggatgatatc
ctcgccttcgagaatgccgaggaatttacaaactattggtggcttgatatgtactgccgg
ggaacatatccggacatccctttaaagtatctgaaggaaaaaggctgggcgccgacaatt
gaagatggggatatggagcttttagcaaaaggaaaacccgattttgtcggtgtgaattat
tatcaaaccatcacatatgaaatgaatcctcttgacggggtatcggaaggaaagatgaat
acgaccggccaaaagggaagcaatcaggaaacaggcatgccgggtttatacaaaacaaaa
aggaaccctcatcttgagacatcgaattgggattgggccattgacccgatcggtctaaga
atcggacttcgcaggatttccagccgctatgggcttccgcttttcataacggaaaacggg
ctgggggaattcgataaggttgaaaatgacggcacgattcatgatgactacagaattgcc
tacttgcgtgcgcaccttgaacaatgcagacaggctttaaacgacggagtcgatttaatc
ggctactgcagctggtcatttacagatttattgagctggctgaacggctaccagaaaaga
tacggtttcgtttatattaaccgtgatgaagagaatgtaaaggacttgaagagaattaaa
aaagacagcttttactggtaccaaaacgtcattcagacaaacggggaagagctttag

DBGET integrated database retrieval system