KEGG   Bacillus licheniformis ATCC 14580: BL01739Help
Entry
BL01739           CDS       T00197                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00220  Arginine biosynthesis
bli00330  Arginine and proline metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01130  Biosynthesis of antibiotics
bli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BL01739 (rocF)
   00330 Arginine and proline metabolism
    BL01739 (rocF)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BL01739 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAU22025
UniProt: Q65NI4
Position
424259..425152
Genome map
AA seq 297 aa AA seqDB search
MNKQVSLIGMPMDLGQARRGVDMGPSAIRYAHIVERLNELGYDIDDLGDVPINRDQPKGD
EGLKNLVSVLEGNRKLADIVDNVVEQRRFPLVLGGDHSIAIGTLAGVAKHYQQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHEKLVNLHGYAPKIKPEHVVIIGARSLDEGER
KYIRETGMKVYTMHEIDRLGMTKVMEETIEYLSANCDGIHLSLDLDGLDPSDAPGVGTPV
VGGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGEAAVELIESLLGKKLL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaagtttctttgattggaatgccgatggacttggggcaggcgcggcgcggt
gtggatatgggaccgagcgcgattcgctacgctcatatcgtggagcgcttaaacgagctg
ggctatgatatcgatgatctgggcgatgtgccgatcaaccgcgatcagccaaaaggagac
gaagggctgaaaaatttagtttccgtactggaaggaaaccgcaagctggccgatatcgtc
gacaatgtcgtcgagcagcgccgcttcccgctcgtgctgggcggagaccacagcattgcc
atcgggacattggcgggtgtagccaagcattatcaacagctcggcgtgatttggtatgac
gcacacggagacctaaatacgcttgagacatcgccgtcaggcaacatccacggcatgccg
ctggcggtaagtctcggtgtcggccacgaaaagctggtcaacctccacggctatgcgccg
aaaatcaaaccggagcacgtcgtcatcatcggtgcgcgctcgcttgatgaaggagagcgc
aaatatatccgtgaaaccggcatgaaagtctataccatgcatgaaattgacaggctcggc
atgacgaaggtaatggaggaaacgatcgagtatttgtcagcaaattgcgacggcatccat
ctgagccttgatctggacggtcttgatccgagtgacgctccgggagtcggcacccctgtc
gtcggaggcatcagctacagggaaagccatttggcgatggaaatgctctatgacgcagat
atcattacatccgccgagtttgttgaagtcaacccgatactggatcataaaaataaaacc
ggtgaggcggccgtcgaactgatcgaatcattgttagggaagaaactgctgtaa

DBGET integrated database retrieval system