KEGG   Bacillus licheniformis ATCC 14580: BL01749Help
Entry
BL01749           CDS       T00197                                 

Gene name
lacA2
Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bli00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
445872..447944
Genome map
AA seq 690 aa AA seqDB search
MVKPYPPISRKVPRLLHGADYNPDQWLKYPDVLKEDIRLMKLSRCNVMSVGIFSWVSLEP
EEGRFTFDWFDQVLDTFKENGIYAFLATPSGARPAWMSKKYPEVLRTERNRVRNLHGKRH
NHCYTSPVYRRKTAIINGKLAERYAHHPAVIGWHISNEYGGECHCELCQDKFREWLLAKF
KTLDRLNDAWWTSFWSHTYTDWDEIESPAPHGEDAVHGLNLDWKRFVTDQTVDFCRHEIA
HVRSFNPDLPVTTNFMGTYAGLNYWKFADLLDVISWDSYPAWHNSRQEDSRLGADIAFVH
DINRSLKGGRPFMLMESTPSMTNWQDVSKLKRPGMHELSSLQAVAHGSDTVQYFQWRKSR
GSSEKFHGAVVDHEGSEHTRVFQEVKKLGEKLEKLEDVAGTTVEPEAAIIFDWENRWALE
DAQGPRNIGKHYERTAKSFYEPFWREGVPVDVIHMEADFSRYKLLVAPMLYMLREGTAER
IEQFVQNGGTFVATYWSGIVDENELTFLGGFPGGLRKTLGIWSEEIDALHDGQKNTIVMD
EENRLGLSGSYEASELCDLIHLEGAEALAAYEDDFYAGRPALTVNLFGDGKAYYIASRNE
AAFQEAFISRLIEECGIAKVLDTELPKGVTAQLRTDGRHDYIFVMNFTAENRSVSLPEET
NTDVLKGTRKKGALKLPPYGTSILRRSHKA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaccgtatcccccgatcagccggaaagttccccgactattgcatggagccgat
tacaacccggatcaatggcttaaatatccggacgtattaaaagaagatatccgcctgatg
aaactgtcccgctgcaatgtgatgtctgtcggcattttctcctgggtttcgctcgagcct
gaagaaggaagatttacatttgactggttcgatcaggttcttgatactttcaaggaaaac
ggaatttatgcgtttttggctacaccgagcggtgccagaccggcttggatgtccaaaaag
tatccagaggtgctgagaacggagcgcaacagggtcagaaaccttcacggaaagcggcac
aatcactgctatacgtcgcctgtctaccgccggaaaacggcgatcataaacggaaagctc
gcggagcgctatgcgcatcacccggccgtcatcggctggcacatttctaatgaatacggc
ggagaatgccattgtgaactttgccaagacaagttcagagagtggctgctggcgaaattc
aaaacgctggaccgccttaatgatgcatggtggacatcgttttggagccatacctataca
gattgggacgagatcgagtcgccggctccgcacggcgaggatgccgttcacggtctgaat
ttggactggaagcgttttgtcacggatcaaacggttgatttttgccggcatgaaatcgcc
cacgtccgttcgtttaaccctgatctgcctgtgacgacgaattttatgggaacgtatgcc
ggattgaattattggaagtttgccgatttgcttgatgtcatctcgtgggattcttatccg
gcatggcacaacagccggcaggaagacagccggcttggagccgatattgcttttgttcat
gacatcaatcgctctcttaaaggcggccggccgttcatgctgatggaaagcacgccgagc
atgacgaactggcaggatgtcagcaagctgaagcgccccggtatgcatgaattgtcgtca
ttacaggcagtcgctcacggatcggacaccgttcagtattttcaatggcggaaaagccgc
gggtcaagcgaaaaatttcacggagcagtcgttgatcatgaaggatcagagcatacgcgc
gtttttcaggaagtgaaaaagctcggggagaagctcgaaaagctggaagacgtcgcaggg
acgacagtcgaacccgaggccgcgattatatttgactgggagaatcgctgggctttggaa
gatgcccaaggtccgcgcaatatcggaaagcattatgaacggaccgccaaatcgttttat
gaaccgttttggcgggaaggcgtaccggttgatgtgattcatatggaggccgatttctcc
cgctataagcttttggtcgccccgatgctctacatgctgcgagaaggcaccgctgaaagg
attgaacagtttgttcaaaacggagggacatttgtcgccacttattggtcgggcattgtt
gatgagaatgaacttacgttcctgggagggtttcctggaggcttaagaaaaacgctcggc
atttggtctgaggagatcgatgctcttcatgacggacagaaaaataccattgtgatggat
gaagaaaacaggctcggattaagcggaagctatgaagccagcgagctttgcgatctgatt
catttagaaggggccgaagcgctcgctgcgtacgaggatgatttttacgcgggccggccg
gcgctgacggtcaatttgttcggagacgggaaggcctactatatcgcttcaaggaatgag
gcggcgttccaagaggcgtttatatccaggctcattgaagagtgcgggattgccaaagtg
ctcgatacagagctcccgaaaggcgtcaccgcccagctccgcacagacggccgccacgat
tatattttcgtgatgaattttacagcggaaaacagaagtgtctcgcttccggaggaaaca
aatacggacgttttaaagggaacccggaaaaaaggcgcgctcaaactgccgccttacgga
acgagcattttacggagaagccataaggcatag

DBGET integrated database retrieval system