KEGG   Bacillus licheniformis ATCC 14580: BL01936Help
Entry
BL01936           CDS       T00197                                 

Gene name
ykcC
Definition
(GenBank) Glycosyl transferase, family 2
  KO
K20534  
polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
Enzymes [BR:bli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BL01936 (ykcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4018212..4019189
Genome map
AA seq 325 aa AA seqDB search
MQKQVTFSIVVPVYNEAEVLQSTYDRLKTVMDSTGDPYELIFVNDGSSDDSIHTLKSLAQ
SDQAVKCINFSRNFGHQIAITAGTDYAAGEAIVVIDADLQDPPELILEMAEKWRQGFDVV
YAVRTKREGETFFKKQTAAMFYRILRKLTDVDIPVDTGDFRLMDRKVVNEMNKLKEKNPF
VRGLVSWLGFKQTAVYYERHERLAGETKYPLKKMLKLSLDGITSFSFQPLKLASYSGIVL
SAIGFIYAFIVVCMKLFTTSTITGWSSMIILQCLFSGFILIILGAIGEYIGRIYDEVKDR
PLYIIDGKYGFEEQRRARAPQRHIM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacaagtcacattttcaatcgtagtacctgtctacaacgaagcggaagtgctt
caaagcacctatgaccgattaaaaaccgtcatggactcgacaggcgatccctatgaactg
atttttgtaaacgatggttcaagcgatgacagcattcacacgctgaagtcgcttgctcag
tcagaccaggcagtaaaatgcatcaatttctcaagaaacttcggtcatcagatcgcgatt
acggccggcacagactatgctgccggcgaggcgatcgttgtgatcgacgccgatttgcag
gatcctcctgaattgattttggaaatggcggaaaaatggcgccaaggctttgacgttgta
tacgccgtccgcacaaagcgagaaggagaaacatttttcaaaaagcaaacggccgccatg
ttctaccggattttaagaaaacttacagacgttgatatcccggtggatacaggagacttc
cggctcatggaccggaaggtggtcaatgaaatgaacaagctgaaagaaaaaaacccgttc
gtccgcggtcttgtcagctggctcgggttcaagcagacagccgtctattacgagcgccac
gaacggcttgcaggggaaacgaagtacccgctgaaaaaaatgctgaagctctcgctcgac
ggcatcacttcattttcctttcagccgctgaaactggcaagctactcaggaatcgtgctg
tcagcgatcggctttatatacgccttcatcgtcgtctgcatgaagctgtttacgacaagc
accattacaggatggtcgtcgatgatcattctgcaatgcttgttcagcggatttatcctg
atcatcctcggggcaatcggcgaatacatcggccgcatttatgacgaagtgaaagacagg
ccgctttatatcattgacggaaaatacgggtttgaagaacagcggcgggcgcgagctccc
cagcgccatattatgtag

DBGET integrated database retrieval system