KEGG   Bacillus licheniformis ATCC 14580: BL01936Help
Entry
BL01936           CDS       T00197                                 

Gene name
ykcC
Definition
glycosyl transferase family protein
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Metabolic pathways
Brite
Enzymes [BR:bli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     BL01936 (ykcC)
Glycosyltransferases [BR:bli01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   BL01936 (ykcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4018212..4019189
Genome map
AA seq 325 aa AA seqDB search
MQKQVTFSIVVPVYNEAEVLQSTYDRLKTVMDSTGDPYELIFVNDGSSDDSIHTLKSLAQ
SDQAVKCINFSRNFGHQIAITAGTDYAAGEAIVVIDADLQDPPELILEMAEKWRQGFDVV
YAVRTKREGETFFKKQTAAMFYRILRKLTDVDIPVDTGDFRLMDRKVVNEMNKLKEKNPF
VRGLVSWLGFKQTAVYYERHERLAGETKYPLKKMLKLSLDGITSFSFQPLKLASYSGIVL
SAIGFIYAFIVVCMKLFTTSTITGWSSMIILQCLFSGFILIILGAIGEYIGRIYDEVKDR
PLYIIDGKYGFEEQRRARAPQRHIM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacaagtcacattttcaatcgtagtacctgtctacaacgaagcggaagtgctt
caaagcacctatgaccgattaaaaaccgtcatggactcgacaggcgatccctatgaactg
atttttgtaaacgatggttcaagcgatgacagcattcacacgctgaagtcgcttgctcag
tcagaccaggcagtaaaatgcatcaatttctcaagaaacttcggtcatcagatcgcgatt
acggccggcacagactatgctgccggcgaggcgatcgttgtgatcgacgccgatttgcag
gatcctcctgaattgattttggaaatggcggaaaaatggcgccaaggctttgacgttgta
tacgccgtccgcacaaagcgagaaggagaaacatttttcaaaaagcaaacggccgccatg
ttctaccggattttaagaaaacttacagacgttgatatcccggtggatacaggagacttc
cggctcatggaccggaaggtggtcaatgaaatgaacaagctgaaagaaaaaaacccgttc
gtccgcggtcttgtcagctggctcgggttcaagcagacagccgtctattacgagcgccac
gaacggcttgcaggggaaacgaagtacccgctgaaaaaaatgctgaagctctcgctcgac
ggcatcacttcattttcctttcagccgctgaaactggcaagctactcaggaatcgtgctg
tcagcgatcggctttatatacgccttcatcgtcgtctgcatgaagctgtttacgacaagc
accattacaggatggtcgtcgatgatcattctgcaatgcttgttcagcggatttatcctg
atcatcctcggggcaatcggcgaatacatcggccgcatttatgacgaagtgaaagacagg
ccgctttatatcattgacggaaaatacgggtttgaagaacagcggcgggcgcgagctccc
cagcgccatattatgtag

DBGET integrated database retrieval system