KEGG   Bacillus licheniformis ATCC 14580: BL01983Help
Entry
BL01983           CDS       T00197                                 

Gene name
proJ
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bli01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bli00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2098131..2099252)
Genome map
AA seq 373 aa AA seqDB search
MTSNQQRVVVKVGSSSLTSLHGEISSKKLEKLVEQIVRLKDEGHEVLLVSSGAVAAGYRK
LGFINRPDTLPEKQASASVGQGLLIEAYSKLFLSHGYIASQILITKSDFSDEKRYNNVRN
TMNVLLKRGIIPIINENDTVTVNRLKFGDNDTLSAKVAGLIDADLLTILSDIDGLYDANP
RKTPDAALVQEVTEITPEIEASAGDAGSEVGTGGMKSKLDAFKITMASGIKGFLGRADTP
GILHEAICGTARGTYFIPNADSHALNHKKQWIAFNSGPEGDIVVHNESKEFIIDRKKSLY
PSSIYDINGRFSNGSVVRILDQEGEEIGLGVVNFSSSQLRKWKKDTNQETAASSQAVVDR
EAFVCHLELSVPL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaatcaacagagggtagttgtcaaagtgggaagcagttctttaacaagtctt
cacggcgaaatcagcagcaaaaagctcgaaaagctcgttgagcagattgtccgcctcaaa
gatgaaggacacgaagtcctccttgtttcatctggcgctgtagcagccggttaccggaag
ctcggctttatcaacaggccggatacattgcctgaaaaacaagcatccgcttctgtcggc
caaggcttattaatcgaagcgtattccaagctttttttatcccacggctatatcgcttca
caaattttaatcacaaaaagcgatttttcagatgaaaaacggtacaacaatgtgagaaat
acgatgaacgtgctgctgaaacgcggcattattccgatcatcaacgaaaatgatacggtt
accgtcaatcggctcaaattcggagacaatgacacgctttctgctaaagtggcgggtctg
atcgacgccgacctgctgaccatcctctctgatatagacggcctttatgacgcgaatccg
cgaaaaacgccggacgccgcactcgtccaggaagtaactgaaatcacgccggaaatagaa
gcttcagcaggggatgcaggaagcgaagtcggaaccggcggcatgaagtccaaactggac
gcttttaaaattacaatggcttcaggcatcaaagggtttttagggcgcgcggacaccccc
ggcattttgcacgaagcgatctgcgggactgcgaggggaacgtattttataccgaatgcg
gattcacacgccctcaaccataaaaagcaatggatagcatttaactctggacctgaagga
gacatcgtcgtccacaacgaaagcaaagagtttattatcgaccgtaaaaaaagcctgtat
ccttctagtatttacgacatcaacggccgtttcagcaacggatccgtcgttcgaatcctt
gatcaggaaggagaggaaatcggcctcggcgtcgtcaacttttcctcatcccagcttcgt
aaatggaagaaggatacgaatcaggaaacagccgcttcctcacaggctgtcgttgacaga
gaagcgtttgtctgtcatttagagctatccgttccgctttaa

DBGET integrated database retrieval system