KEGG   Bacillus licheniformis ATCC 14580: BL02037Help
Entry
BL02037           CDS       T00197                                 

Gene name
yrrC
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BL02037 (yrrC)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BL02037 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2761249..2763648)
Genome map
AA seq 799 aa AA seqDB search
MMQRHNPDQIEMEEASFVKGTVTAVIYHNETNLYTVLKVKVEETSESFEDKTVSVTGYFP
LIHEDDIYTFYGKTASHPKFGLQFQADHFKKEVPTTKEGVIQYLASDLFEGIGKKTAEEI
VNKLGEGAINKILSDGAVLYDVPKLSKKKADKLAAALQQHQGLEQIMISLSEFGFGPQLS
MKIYQAYEAETLDKIRENPYQLVKDVEGIGFIKADELGGRMGISGKHEERIKAAILYTVE
ATCLQEGHTYIETRQLIIETQKLLNQSAGDEKVTEMDVADAIISLGEQKELFIEDERCYY
PSLYYAEQSFAKRVQKIAGQTEYDDQFPESEFLLALGELEERMKVQYAPSQKEAIQKALM
SPMLLLTGGPGTGKTTVIRGIVELYSELHGLSLNPADYKKDETFPFVLAAPTGRAAKRMS
ESTGLPAVTIHRLLGWNGAEGFTHDEDNPIEGRLLIIDETSMLDIWLANQLFKAIPDRIQ
VIMVGDEDQLPSVGPGQVLRDLLASNVIPSVRLTDIYRQAEGSSIVELAHEMKQGKLPEN
LAAPTKDRSFIRCRQQQIKEVVEKVVKNALQKGYSARDIQVLAPMYRGAAGINELNALLQ
GILNPPKPKGREMKYGDVVYRTGDKVLQLVNQPEHNVFNGDMGEIVSIFYAKENTEKEDM
AVVSFDGNEITFAKKDFNQFTHAYCCSIHKSQGSEFPIVILPVVKSYYRMLRRNLLYTAI
TRSKKFLILCGEEEALEWGVKNKESSERQTSLKRRLQQAAHEEDEELMALQKELPFSVYD
ANIGMEGITPFDFMEKEAE
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcagcgccataacccggaccagatcgaaatggaagaagcttcatttgtaaaagga
acggtaacggctgtcatatatcataatgaaacaaacctgtataccgtactgaaagtaaaa
gtggaagaaacatcagagtcttttgaagacaaaaccgtttctgtcaccggttactttcct
ttgatccatgaagacgatatctacacattttacggaaaaaccgcctcccatccgaaattt
ggcctgcaatttcaagcggatcatttcaaaaaggaagtgccgacaacgaaagaaggcgtg
atccaatacttggccagcgatttatttgaaggaatcggcaagaaaacggccgaggaaatt
gtcaataagctgggggaaggggcaatcaacaaaattttaagcgacggcgccgtcctgtat
gatgtcccgaagctctccaaaaaaaaggcggataagcttgccgctgcccttcagcagcat
caggggctcgagcagattatgatctccttgagcgaattcggcttcggcccccagctgtcc
atgaaaatttatcaggcgtacgaagcggaaacgctcgataaaatccgcgaaaatccgtac
cagcttgtcaaagatgttgaaggaatcggctttatcaaagcagacgaactgggcggcaga
atggggatctcaggcaaacatgaagagcggatcaaagcggcgattttatacacggttgaa
gcgacatgccttcaagaagggcatacgtacatagaaacgagacagctcatcatcgagacg
caaaagctgttaaaccagtcagcaggcgatgaaaaagtaaccgagatggatgtggcggac
gcgatcatttccttaggggagcaaaaagagctgttcattgaagatgaaaggtgttattat
ccgtccctttactacgctgaacaaagctttgccaaaagggtgcagaaaatcgccggacag
accgaatacgatgaccagtttcccgaatcggaattcctgctcgctttaggggagcttgaa
gaacggatgaaagtgcagtacgcgccaagccaaaaagaagccatacaaaaagcgctgatg
tcgccgatgctgcttttgacgggcggaccgggaaccgggaaaacgaccgtcatcagggga
atcgtcgagttgtacagcgagctgcacggcttaagcttaaatccggctgattacaaaaaa
gatgaaacgtttccgtttgtgctggcagcaccgaccggccgggccgctaagcggatgagc
gagtcgaccggtctgccggccgttacgattcacaggcttctcggctggaacggagccgaa
ggatttacgcacgatgaagacaatccgattgaaggacggctgctcattattgatgaaacg
agcatgcttgatatatggcttgccaaccaattattcaaggcgatccccgatcggatacag
gtgatcatggtcggagatgaagaccagcttccgtccgtcggtcccggacaggtgctaagg
gatctgttggcatcgaatgtgattccttctgtcagattaaccgacatttacagacaggct
gaaggctcttcaatcgttgaactggcgcacgaaatgaaacagggaaagcttccggaaaac
ttggccgccccgacaaaagaccgttcttttattcgctgccgccagcagcagatcaaagaa
gtcgtcgaaaaagtcgtcaaaaacgcgctgcaaaaaggatattcggccagggatattcag
gttttggctccgatgtacagaggagcggccggcatcaatgagttgaacgcccttttgcag
ggcatactgaatccgccgaagccgaaaggcagggaaatgaagtacggagatgtcgtgtac
cgtaccggagataaagtgctccagctcgtcaaccagccggagcataacgtgtttaacggt
gacatgggcgagatcgtctcgattttttatgcgaaagaaaatacggaaaaagaagatatg
gccgttgtctctttcgacgggaatgaaatcacgtttgcaaaaaaagatttcaaccagttt
acgcacgcctattgctgttcgatccacaaatcgcaaggcagcgaatttccgatcgtcatc
cttccggtcgtcaaaagctattaccggatgctgagaaggaacttgctttacacggctatt
acaagaagcaaaaaattcctgattctgtgcggcgaagaggaagcccttgaatggggcgtg
aaaaataaggaatcatcagaaaggcagacatcgcttaaaagacggcttcagcaggcggca
catgaagaggatgaagagctcatggcgcttcaaaaagagctgccattcagcgtctatgac
gccaatatcgggatggaaggcattacaccttttgattttatggaaaaggaagcagaataa

DBGET integrated database retrieval system