KEGG   Bacillus licheniformis ATCC 14580: BL02065Help
Entry
BL02065           CDS       T00197                                 

Gene name
thrCA
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00260  Glycine, serine and threonine metabolism
bli00750  Vitamin B6 metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01230  Biosynthesis of amino acids
Module
bli_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL02065 (thrCA)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BL02065 (thrCA)
Enzymes [BR:bli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BL02065 (thrCA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAU24287
UniProt: Q65H14
Position
complement(2669612..2670715)
Genome map
AA seq 367 aa AA seqDB search
MEQYQCHSCRTKYNVSEQVWKCQCGGVLDLVKEKVEWSDSKVLKDIPSMWRYIEAMPFDR
DSAIWSGITMGEGYTPLIVLDSGEPNTLVKVDYMMPTLSFKDRGAAVLIAKAKELGVKHV
IADSSGNAGTSIAAYAKRAEIACDIFLRKGTSPKKIAQAKAHGANVREIEGTREDVAEAA
QKAVDIEKKFYASHVFNPYFYEGTKTYAFEIWEQMNGAPDTLIIPVGNGTLLLGVYYGFK
ELLENKCIDKMPRLVAIQAENCAPLAKAFINNQKAAEPVKSSGTLAEGIAIAKPARSAQI
LETIRATNGQIITTNEEEILKARTALASKGFYVEPTTAANYAGYLKYSHSSDEKIVIPLC
GAGIKSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtatcaatgtcattcttgccgtacgaaatacaatgtgtctgaacaggtgtgg
aaatgccagtgtggcggagtgttagaccttgtaaaagaaaaagtagaatggtccgattca
aaagtgctcaaagatattccttctatgtggagatatattgaagctatgccatttgatcgc
gactccgccatatggagcggcatcaccatgggggagggatacacgcctttaatcgtgtta
gacagcggggagccgaatactcttgtgaaagtggactatatgatgcctactttgtctttt
aaagatcgcggtgcggctgtattaatagctaaggcaaaggagctgggagtgaagcatgtg
atcgccgacagcagcggaaatgcagggacatctattgcagcttacgccaagcgggctgaa
atcgcatgtgacatctttcttcgaaagggtacatcgcctaagaaaatcgcgcaggcgaaa
gcgcatggagccaacgttcgcgaaattgaaggcacaagagaagatgtggctgaagcagcg
caaaaggctgtggatatagagaaaaaattctatgccagtcacgtttttaatccatatttc
tatgaaggaacaaaaacgtatgcctttgagatttgggaacaaatgaatggagcgccggat
acgcttattattccagttggcaatggtacgttattgcttggggtttactatggatttaaa
gagttattagagaacaaatgtatagacaaaatgccaaggctggttgcgatacaggcagag
aattgtgcgccgttggcaaaggcatttatcaacaatcaaaaagctgctgaacccgtcaaa
agcagcggaacacttgcagagggcatcgcgattgccaaaccggcaagatctgctcaaata
ttagaaaccatccgtgccacaaacggtcaaatcattacaaccaatgaggaagagattcta
aaagctcgtacagcattagcaagtaaaggcttttatgttgagccaacaacagcggctaac
tatgcaggatatttaaaatacagtcattcttctgatgaaaaaatcgtgattccattatgc
ggggctgggattaaatctaattag

DBGET integrated database retrieval system