KEGG   Bacillus licheniformis ATCC 14580: BL02273Help
Entry
BL02273           CDS       T00197                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bli00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bli00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1726066..1726986
Genome map
AA seq 306 aa AA seqDB search
MKHLTAMNELSLEDIHELIEEARELKKGKSDSVLSGKFAANLFFEPSTRTRFSFEVAEKK
LGMNVLNLDGVSTSVQKGESLYDTVKTLESIGADVCVIRHSHDHYYDELIGHVGIPVINA
GDGCGQHPTQSLLDLMTIHEEWGRFAGLTVSIHGDIKHSRVARSNAEVLTRLGAKVLFSG
PDEWRDEDNPYGTYVSPDEAVAHSDVVMLLRIQHERHEKKAAERDYLETFGLSLKRAELL
KKDAVIMHPAPVNRGVEIDSALVESGRSRIFKQMENGVYIRMAVLKRALLNGENKKRGDQ
AYVLFN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacttgaccgcaatgaatgagcttagtcttgaggatattcacgagctgattgaa
gaggcgagagagctgaaaaaaggcaagtccgattccgttctctccggaaagttcgctgcc
aacctgttttttgaaccgagcacaagaacgcgcttcagcttcgaagtggctgaaaagaaa
ctcggcatgaatgtgttgaacctggacggtgtttcaacgagcgtacaaaaaggagaatcg
ttgtacgataccgtcaagaccctcgaatccatcggcgctgatgtatgtgtgatcagacac
tctcatgatcattattacgatgaactcatcggacatgtcggcattccggtgatcaatgcc
ggagacggctgcggtcagcatcccactcagtctttgctcgatttgatgacgattcacgag
gaatggggcagatttgccggactgacggtatccatacacggagatatcaagcacagcaga
gtggcaaggtccaatgccgaagtgctgacaagactcggagcaaaggttcttttctcaggt
ccagacgaatggcgggatgaagacaatccatacgggacatatgtgtcgcctgacgaagcg
gttgcacattcggatgtcgtgatgcttctccggattcagcacgaacggcatgagaaaaag
gcggcagaacgcgattatctcgaaacattcggattgtcgctcaagcgggcggagctcttg
aaaaaagacgcggtcatcatgcaccccgcacctgtcaaccgaggcgtcgagattgacagt
gcactggtcgaatccggccggtcgaggatttttaaacaaatggaaaacggagtatatatc
agaatggcggttttaaaaagagcgcttctaaacggcgaaaacaaaaaaaggggagatcag
gcttatgtcttatttaattaa

DBGET integrated database retrieval system