KEGG   Bacillus licheniformis ATCC 14580: BL02293Help
Entry
BL02293           CDS       T00197                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BL02293 (gmk)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BL02293 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1747761..1748375
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQALFAQEDTKFEYSISVTTRKPRQGERDGVDYFFKTRE
EFEEMIENNKLLEWAEYVGNYYGTPVDYVEQTLESGRDVFLEIEVQGALQVRKAFPEGLF
IFLAPPSLAELKNRIVTRGTETEATIENRMKAAKEEIELMDAYDYVVENDSIELACERIK
AIVLAEHLRRDRVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagaggtttgttaatcgttctctccggcccttccggcgtcggaaaaggaaca
gtcaggcaggcgctgtttgctcaggaggacacaaaatttgaatattcgatttcggtgacg
acaagaaaaccgcgtcaaggcgaaagagacggcgtcgactacttttttaagacgcgcgaa
gagttcgaagagatgatcgagaacaacaagctgctcgaatgggccgaatatgtcggcaac
tattacggaacacccgttgactacgtcgaacagacgcttgaaagcggaagggacgttttt
cttgaaatcgaagtccagggtgcgctgcaagtcagaaaggcatttcctgaaggcttgttt
atctttttggcgcctccgagcctcgccgaattgaaaaaccggattgtcacaagagggaca
gaaacagaagccacgatcgaaaaccggatgaaagcggcgaaggaagaaatcgaactgatg
gacgcctatgactatgttgtcgaaaatgacagcattgagcttgcgtgcgaaagaatcaaa
gcaatcgttctcgccgaacatttacggcgcgaccgagttgctccaagatataagaaaatg
ctggaggttgaataa

DBGET integrated database retrieval system