KEGG   Bacillus licheniformis ATCC 14580: BL02301Help
Entry
BL02301           CDS       T00197                                 

Gene name
prpC
Definition
(GenBank) protein phosphatase
  KO
K20074  
PPM family protein phosphatase [EC:3.1.3.16]
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
Enzymes [BR:bli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BL02301 (prpC)
Protein phosphatases and associated proteins [BR:bli01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    BL02301 (prpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1756187..1756951
Genome map
AA seq 254 aa AA seqDB search
MKTALKTDRGKIRQHNEDDAGIFTEKNGLVLAVVCDGMGGHLAGDVASRMAVSALRDIWE
ETEEVPASPAESEAWLKEQISAVNQKLFDHSRAHEECQGMGTTVVCALYTGKTLTVAHIG
DSRCYLLQGGSFIQLTEDHSLVNELVRTGGISKEDAEHHPRKNVLTKALGTDPEVKVEAH
TFEIEPGDQVLLCSDGLTNKVDDETLKDMLTTLSSAEEKADQLVQLANDNGGEDNITVAL
LELPSQIEEGEDKC
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacagccttaaaaacggacaggggaaaaatacgccagcacaatgaagacgatgcc
ggcattttcacagaaaaaaacggactggtattagctgttgtctgcgatggaatgggaggt
catctggccggcgatgtcgccagcaggatggccgtctcagcccttcgtgatatttgggag
gaaaccgaagaagtcccggcttcgccggctgaaagcgaagcgtggctgaaagagcagatt
tcagccgtcaaccaaaaacttttcgaccattcgagggcccacgaagagtgccagggaatg
gggacaacggtcgtctgcgctttatacacgggaaaaacgctgacggtcgcccatatcgga
gacagccgctgctatctcctgcaaggcggaagtttcatacagctgacggaagatcactcg
cttgtcaatgaactcgtgcggactggggggatttcgaaggaggatgctgaacaccatccg
cggaaaaacgtgctcacaaaagcgctcggcacagatcccgaagtgaaggtagaagcccac
acatttgaaatcgaaccgggtgatcaagtgctattatgttctgacgggctgacgaataaa
gtggatgatgagacactgaaggatatgctcacgactctttcttctgcggaggagaaagcg
gatcagctcgttcagctggccaatgacaacggcggcgaagacaatatcaccgtcgcgcta
ttggaacttccttctcaaattgaagaaggtgaagacaagtgttaa

DBGET integrated database retrieval system