KEGG   Bacillus licheniformis ATCC 14580: BL02335Help
Entry
BL02335           CDS       T00197                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL02335
Enzymes [BR:bli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BL02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759679..761145
Genome map
AA seq 488 aa AA seqDB search
MTKTKGFPKDFLWGGAIAANQAEGAWNVDGKGPSVADIAMYRSNLSVEDYEGHLAVSSEN
IERAMKDPDVKKYPKRRGIDFYHHYKEDVALFAEMGFKTLRISIAWSRIFPTGEEAEPSE
KGLQFYDRLFQEMKKHNIEPIVTLSHYEMPLALSLKYNGWVERKVIDLFVKFANVCFERY
KDVVKYWLTFNEIDSIHRHSFITAGIIPDRCPEGKVEETVYQALHHQFVASALVTADCHR
IIPGSQVGCMLTKLTTYPHTCHPSDVERALKQNLDNYFYADVQVFGEYPPLIKRMLERKN
INIKMEADDLAIIKEHTVDFVSFSYYMSLTESAQEGLEKTDGNTIRGVKNPYLPSTDWGW
QIDPVGLKISLIELYDRYQKPLIIVENGMGAKDVVESDGSIHDDYRISYFREHFRQMKEA
IEEGVDLFGYTSWGPIDIISAGTSQMSKRYGFIHVDQDDDGNGTLKRSRKDSFYWYKKVI
ETNGEVLD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacaaaaggatttccaaaagattttttatggggcggtgcgattgccgcaaac
caagcagaaggagcctggaatgttgatggaaaaggaccgtctgttgctgatattgccatg
taccgttcgaatttgagtgttgaagattacgaaggacatcttgctgtttcttctgaaaac
attgaacgcgcaatgaaagacccggacgtaaaaaaatatccgaagcgcagagggattgac
ttttatcatcactataaagaagatgtggctctctttgcagaaatgggttttaaaacattg
cgtatatcgattgcatggagccgaattttcccgacaggagaagaagcagagcctagcgag
aaaggccttcagttttatgatcgtctgtttcaagaaatgaaaaaacataacattgaaccg
atcgtgactctgtcacattatgaaatgccattagcacttagtctgaaatacaacggatgg
gttgaaagaaaagtgatcgacctctttgtgaaatttgccaatgtgtgttttgaacgctat
aaagatgtcgtaaaatactggcttacctttaatgaaattgacagtatacatcgccattct
ttcattacagcgggaatcattcctgatcgctgtcctgaagggaaagtagaagaaacggtt
tatcaagcattgcaccatcaatttgtggcatccgctcttgtgactgcagattgtcatcgc
atcattcccggcagtcaggtgggatgtatgctaacgaaactcacgacatacccgcacact
tgccatccgagtgatgttgaacgcgcactgaagcaaaaccttgataactatttctatgca
gatgttcaagtgtttggcgaatatccgccattgatcaaacgcatgctggaacgaaaaaat
atcaatattaagatggaagcggacgatcttgccattataaaagaacatacggtagacttc
gtttcgtttagctactatatgtccctgacagaatctgcacaggagggtctggaaaaaaca
gatggcaatacgattcgcggtgtgaaaaatccatatttgccgtcaacagattggggttgg
caaatcgatccggtcggcttaaagatttcgctcattgaattgtatgatcgctatcaaaaa
cctctcattattgtggagaacggcatgggtgcgaaagatgttgtcgaaagcgatggatcg
atccatgatgactatcgtattagctatttcagagagcatttccgtcagatgaaagaagcc
attgaagaaggtgttgatctctttggatataccagctggggacccattgacattattagt
gcgggaacatctcaaatgtccaaacgatatggatttatccatgttgatcaagatgacgat
ggcaacgggacattgaagcgctcacgtaaagattcattctactggtataagaaagtgatt
gagacaaacggagaagtattagactaa

DBGET integrated database retrieval system