KEGG   Bacillus licheniformis ATCC 14580: BL02359Help
Entry
BL02359           CDS       T00197                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BL02359 (recR)
DNA repair and recombination proteins [BR:bli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BL02359 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33141..33737
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLSMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcctgaaccaatatcaaagctgattgacagctttatgaaattgccaggaatc
ggacccaagacggcggtccgtctggctttttttgttcttagtatgaaagaagacgtcgtg
ttagattttgcaaaagcattggtaaacgcaaagcgcaatttgacatattgctcggtctgc
ggacatataacagatcaagatccttgctatatttgtgaagatacgagaagagacaaatcg
gtcatatgtgttgttcaggatcccaaagatgtcattgctatggagaaaatgaaggagtac
aacggactgtaccatgttttgcatggagcgatttctccgatggacggcatcggtccggaa
gatattaaaatacccgaattgctgaagcggttgcaggatgatcaggtgactgaagtcatt
ctcgcgacaaacccgaatatagaaggagaagcaacggccatgtacatttcaaggctttta
aagccgtctggtatcaagctgtcacgaattgcccatggacttccggtcggaggcgatttg
gagtatgcagatgaagtcactctttctaaagcgcttgaaggcagacgtgaaatgtag

DBGET integrated database retrieval system