KEGG   Bacillus licheniformis ATCC 14580: BL02366Help
Entry
BL02366           CDS       T00197                                 

Gene name
dck
Definition
(GenBank) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00230  Purine metabolism
bli00240  Pyrimidine metabolism
bli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BL02366 (dck)
   00240 Pyrimidine metabolism
    BL02366 (dck)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BL02366 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BL02366 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 SKI AAA_17 Cytidylate_kin2 TsaE AAA_22 RsgA_GTPase AAA_5 RNA_helicase AAA_16 Cytidylate_kin ABC_tran AAA_14 Rad17 AAA AAA_25 PRK ParA MMR_HSR1 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AAU21662
UniProt: Q65PK6
Position
complement(26773..27414)
Genome map
AA seq 213 aa AA seqDB search
MSVYDIPKDAIITVAGTVGVGKSTLTKELAKRLGFKTSLEEVVNNPYLEAFYQDFERWSF
HLQIFFLAERFKEQKYIYESGGGFVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSLFE
AMVMTPYFPRPDVLVYLEGDLETILDRIQKRGREMELLTDRSYWEEMYTRYENWISGFNA
CPVVRVNIDEYDLFNNSASLDPIIEKISEAIQR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatatgatattccgaaagatgctatcattactgttgcaggaacggtaggagtg
gggaaatccacattgacaaaagagcttgcaaaaaggctcggatttaaaacctctcttgaa
gaggtcgtgaataacccttatttggaggctttttaccaagactttgaacgctggagcttt
cacctgcagattttcttcttggcagagcgcttcaaagaacaaaaatacatttacgaatcg
ggcggcggatttgttcaggaccgttcaatttatgaagatacaggcattttcgccaaaatg
cacgccgataaaggcacaatgtcaaaagtcgactataagacgtatacgagcctgtttgaa
gcgatggtcatgacgccttacttcccccgccccgacgttttagtctatttagagggcgat
ttggaaacgattctcgaccgcatccaaaaacgcggacgggaaatggaactgttaaccgac
agatcgtattgggaagaaatgtacactaggtatgaaaactggatcagcggatttaacgcc
tgtccggttgtcagagtcaatattgatgaatacgacctgttcaacaactcagcctctctc
gatccaatcattgaaaaaatcagtgaagccattcaaagataa

DBGET integrated database retrieval system