KEGG   Bacillus licheniformis ATCC 14580: BL02644Help
Entry
BL02644           CDS       T00197                                 

Definition
(GenBank) Malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BL02644
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BL02644
   00630 Glyoxylate and dicarboxylate metabolism
    BL02644
Enzymes [BR:bli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BL02644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4038881..4040470)
Genome map
AA seq 529 aa AA seqDB search
MKTEEKRIHITGSINPHYEEILTKEAMEFIGRLERHFGGRRRELLHLRTIRQAEIDQGKN
PCFLAETKHIREADWTVAPLPRDLEDRRVEITGPVDRKMVINALNSGAKVFMADFEDANS
PTWKNCIEGQVNLRDAVRGTISFTNEQGKRYELKENPAVIMVRPRGWHLEEKHVLIGGRP
VSASLFDFGLYFFHNAKELIKKGSGPYFYLPKIENHLEARLWNDVFVYAQNDLRIPQGTI
KATVLVETILAAFEMDEILYELKEHSAGLNCGRWDYIFSFIKKFRNRDEVILPDRSAVTM
TVPNMRAYSLLAIQTCHKRNVHAIGGMAAQIPAKDKPEINEAAFAKIREDKEREVKDGHD
GTWIAHPGMIQTALDVFNQHMPSANQIHRKRKDVKVEEKDLLEVPKGRITEAGVRTNISA
GIRYLASWLSGRGAAPIDHLMEDAATAEISRAQLWQWIRHPKGVLDDGRKVTAEMVKMMK
EKEMQKIIDEAGVEHFRSGRFEEAGQLFEQLILDDEFAEFLTIPAYENI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagaggagaagagaattcatataaccggatcgataaatccgcattatgaagag
attttgacaaaagaagcgatggagtttatcggacgtcttgaacgccatttcgggggaaga
agacgggaattgctgcatttgcggacgatcaggcaggctgaaattgatcaagggaagaac
ccttgttttttggcggaaacgaagcacatccgcgaggcggactggacagtcgcgccgctc
ccccgggatttggaggaccgcagggttgaaatcactggcccggtcgacagaaaaatggtc
atcaacgctttaaattcaggagcgaaagtctttatggccgactttgaagatgcgaactcg
ccgacgtggaaaaactgcattgaaggccaggttaatttgcgggatgcggtccgcgggacg
atttcttttacgaatgaacagggcaaacgctatgagctgaaagagaaccccgccgttatc
atggtcaggccgaggggatggcacttggaagaaaagcatgtgctgatcggcggcaggccc
gtgtcagcaagcctgttcgattttggtctttattttttccataacgcaaaagagctgatc
aaaaaaggaagcggcccttatttctaccttccaaaaatcgaaaaccacctggaagcaagg
ctgtggaacgacgtatttgtttatgcgcaaaacgacttgcgcattccgcagggcacgatt
aaagcgacggttctcgttgaaacgatcctggcggcctttgaaatggatgaaatcctctac
gaattgaaggaacattcagccgggcttaactgcggcaggtgggattatattttcagcttt
attaagaaattcaggaacagggatgaagtcattcttccagatcgctcagccgtgacgatg
acagttcccaacatgagagcctactccctcttggcgattcaaacgtgtcataaacgcaac
gtccatgcgattgggggaatggcggcgcaaattcccgctaaagacaaacctgagatcaat
gaagccgcatttgccaaaatccgcgaagataaggaacgtgaagtaaaagacggccatgac
ggaacatggatcgcgcatcccggcatgattcaaacggcgctcgatgtattcaatcagcat
atgccgtcggcgaaccagattcatagaaagcggaaagacgtaaaggtcgaggaaaaagac
ttgctggaagtaccgaaaggcagaattacagaagcaggcgtccgtaccaatatcagcgcc
ggcatccgctatttagcttcatggctgtcgggcagaggcgccgctccgatcgaccactta
atggaggacgctgcaacggcggagatttccagagcccagctgtggcaatggattcgccat
ccgaaaggagttcttgacgatggccggaaagtcaccgcggaaatggtcaagatgatgaaa
gagaaagaaatgcagaaaatcatcgatgaagcaggcgtggaacattttcggagcggccgg
tttgaagaggccggacagttatttgaacagctgattttggatgatgaattcgcggagttt
ctaacgataccggcttatgaaaatatataa

DBGET integrated database retrieval system