KEGG   Bacillus licheniformis ATCC 14580: BL02646Help
Entry
BL02646           CDS       T00197                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BL02646
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BL02646
Enzymes [BR:bli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BL02646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4037595..4038866)
Genome map
AA seq 423 aa AA seqDB search
MLKEKQLAESWEHDERWKGITRPYEAADVIRLRGTLEIEYTIARRGAEKLWKLLHTEDFV
PALGALTGNQAMQQVKAGLKAIYLSGWQVAADANMSGSMYPDQSLYPANSVPEVVKKINR
TLQRADQIHHMEGKEDIDWFAPIVADAEAGFGGQLNVFELMKSMIEAGAAGVHFEDQLSS
EKKCGHLGGKVLLPTQTAVRNLIAARLAADVMGVPTILIARTDANAADLITSDVDSYDAP
FLTGERTAEGFFKTKPGLDQAIARGLAYAPYADLIWCETSEPNIEEARRFAQAIHEKFPG
KLLAYNCSPSFNWKAKLDDNTILNFQKQLSEMGYKFQFVTLAGFHALNHGMFELARQYKH
RGMAAYSDLQQAEFASEVHGYTATRHQREVGTSYFDEVAQVVTGGTSSTTALKGSTEAEQ
FQS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagaaaaacaactcgcagaaagctgggagcatgatgaacgctggaaagggatc
acaaggccgtatgaggcggcagacgtcattcggctgaggggcacgctcgagattgaatac
acgattgcaaggcgcggcgccgaaaagctgtggaagcttctccatacagaggatttcgtc
ccggcgctgggcgctttgaccggaaaccaagccatgcagcaagtaaaggccggattgaaa
gcgatttatttaagcggctggcaggtggctgccgatgcaaatatgtcagggagcatgtat
cctgaccaaagcctttatccggcaaacagcgtcccggaagtcgtcaaaaaaatcaaccgc
acgctgcagcgcgccgatcaaatccaccatatggaaggaaaggaagacatcgattggttt
gctccgattgtggccgacgctgaagcgggcttcggcgggcagctgaatgtgttcgagctg
atgaaaagtatgattgaagccggcgccgcgggagttcactttgaagaccagctgtcgtct
gagaaaaagtgcgggcatttgggcggaaaagtgctgcttccgacgcaaacagcggtacgt
aatttgattgccgcgcgcctcgccgcagacgtgatgggagtcccgaccattcttattgcc
cgcacggacgcgaatgcggcagacctgatcacaagcgacgtcgattcatatgatgcaccg
tttttgacgggagagcgaacagcggaagggttcttcaaaacaaagcctggccttgatcag
gcgattgccagaggcttggcgtatgcgccgtatgccgatttgatctggtgtgaaacgtct
gagccgaatattgaagaagcccgccggtttgcacaggcgatccatgaaaaattcccgggc
aaactgctcgcctacaactgttccccttcgttcaactggaaggccaaactggatgacaac
acgatcttgaacttccagaaacagctcagtgaaatgggctataaatttcaatttgtcaca
ctggcgggcttccacgccttaaatcacggcatgtttgaattggcccgccaatataagcac
cgcggaatggcggcgtactctgatctgcagcaggccgagtttgccagcgaagtccacggc
tatacggcgacaaggcatcagcgcgaagtcggaacgagctactttgatgaagtcgcccag
gttgtgacaggcgggacttcatcaaccactgcactgaagggatcgactgaagcggaacag
tttcaatcataa

DBGET integrated database retrieval system