KEGG   Bacillus licheniformis ATCC 14580: BL02664Help
Entry
BL02664           CDS       T00197                                 

Gene name
yngB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BL02664 (yngB)
   00052 Galactose metabolism
    BL02664 (yngB)
   00500 Starch and sucrose metabolism
    BL02664 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BL02664 (yngB)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BL02664 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1286938..1287828)
Genome map
AA seq 296 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVQSGIEDILIITGRNK
RSIEDHFDRSVELEQNLLAKGKNDVLKEIREIADMANIHYIRQKEPIGLGHAVLSAKHFI
GDEPFAVLLGDDIMVSETPALRQLLEVYEEYQTEVIGVQPVDPADVSKYGIIQTSAQKNK
VYQIDDLVEKPTVKDAPSNIAVMGRYVLRPSIFPVLEQTKRGAGNEIQLTDALREICREQ
SMYARKLKGSRFDIGDKLGSFKASTEIALMRDEMRPKLLAYLESVLKKEAQKGAWQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaaaagcagtcatcccagcagccggattaggtacgagatttttgccggca
acaaaagcgcagccgaaagaaatgctgccgattgtcgataaaccggccatacaatatatc
gtggaagaagctgtccaatcaggcattgaagacatccttatcattacaggaagaaataag
cgttcgattgaagaccattttgaccgctctgtggaacttgagcaaaacctgctggccaaa
ggaaaaaacgatgtgttaaaagagatacgcgagatcgccgatatggcgaatattcattat
atccggcaaaaggagcccatcggcctcggacatgcagtgttatcggccaagcatttcatc
ggtgatgagccgtttgccgtcctcctcggcgacgatatcatggtgtcagaaacaccggcg
cttaggcagctgctcgaagtatatgaagaatatcagaccgaagtgatcggcgttcagccc
gtcgatccagcggacgtgagcaaatacggcatcattcagacatccgcgcaaaagaacaaa
gtgtatcaaatcgacgatcttgtagaaaagccgaccgtcaaagatgcgccttcaaatatc
gcggtcatgggccgctatgtgctgaggccttcgattttccctgtgctcgaacaaacgaag
cgcggcgcgggaaatgaaattcagctgactgacgcactaagggaaatctgccgggaacaa
agcatgtatgcgcgcaaattgaaaggaagccgctttgatatcggcgacaagctgggcagc
tttaaagcgagtacggaaatcgccctcatgcgggacgagatgcggccaaaactgctcgcc
tacctggagagcgtcttaaaaaaagaagcgcagaaaggagcatggcaatga

DBGET integrated database retrieval system