KEGG   Bacillus licheniformis ATCC 14580: BL02695Help
Entry
BL02695           CDS       T00197                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BL02695
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BL02695
Enzymes [BR:bli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BL02695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(582347..583261)
Genome map
AA seq 304 aa AA seqDB search
MAKKTIRLLMPQWQGGNNPNYSFGAELLAWLAPENDQPLIHVPVQPYDGTPLENENGING
RKQLLEQLEAAQHIIHAHKPDRIVMFGGDCLVEQAPFAYLNERYGGDLGLIWIDAHSDLV
RYAGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLAAPTEEETKVISNELQRQ
GIAPTEPDTEVIQRLGIRTAGTKKLMTSTEPIKEWIKESNIKYLAIHLDLDVLDPKAFRS
LLFANPEAPVNFSPEGTMQMPYLLHLLKELSSETDVVGLGITEHLPWDSIHLKKLLSEIP
ILTQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaacaattcgtctgttaatgccgcaatggcaagggggaaacaatcccaac
tactcttttggagcagaactgcttgcttggctggctcctgaaaatgatcagccccttatt
catgttccggttcaaccttatgatggaactccgcttgaaaacgaaaacgggataaacggg
agaaaacaactgctggaacaattggaggctgctcagcatatcattcatgctcataagccg
gatcgcattgtcatgtttggcggtgactgcttagtcgaacaagcaccatttgcttattta
aacgaacgatacggcggggacttaggtttaatttggattgacgctcatagcgatttagtt
agatatgccggttatgacaacggtcatacattaccgctcgggaatcttttgggagaagga
gatgaagagttcgcaaaacatgtgaaaattcccctgaaacctgaaaatgtctttattgcg
ggattagcagctcctacagaagaagaaacaaaagtgatatcaaatgaacttcaaagacaa
ggtatagctcccacagaaccagacactgaagtgattcaaagacttgggattagaactgcc
ggaactaaaaagttaatgaccagtaccgaacctataaaagaatggataaaagaaagcaac
atcaagtatctggcaatacaccttgatttagacgtgcttgatccgaaggcgtttcgttct
ttattattcgccaatcctgaagcacctgtaaatttttctcctgagggaacaatgcaaatg
ccgtacctgcttcatcttctgaaagaactctcttccgaaacggatgtggttggattaggt
ataaccgagcatttgccgtgggattctattcatttgaagaaattgcttagtgaaatccct
attttaacccaataa

DBGET integrated database retrieval system