KEGG   Bacillus licheniformis ATCC 14580: BL02716Help
Entry
BL02716           CDS       T00197                                 

Gene name
ybbD
Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BL02716 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BL02716 (ybbD)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BL02716 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(169102..171033)
Genome map
AA seq 643 aa AA seqDB search
MKRFLQCALIALLLSSLALQPAAREAEAKQRPEQNIKQMVSSMSLEEKIGQMLMPDFRNW
KKKGESSAKGLTEMNDEVAGIIEKYRLGGVILFAENVTGTEQTVRLTDGLQQASPDIPLF
ITIDQEGGIVTRLESGTNLAGNMAVGASRSSKNAFRSGKIIGKELSSLGINVNFSPVLDV
NNNPDNPVIGVRSFSSKPELTSKLGIQMMKGLQDEQMIATAKHFPGHGDTAVDSHYGLPL
VPHNEKRLRSVELAPFQKAIDAGIDMIMTAHVQFPAFDDTTYKSKKDGEDIMVPATLSKK
VMTDLLRKDLSFKGVVVTDALNMKAISDNFGQEEAVVMAVKAGVDIALMPAQVTSLETEK
NLARVFEALLTAVKNGDIPMEQIDQSVERILQLKIDRGIIDHTGSEPLQKKIKYALKTVG
SSKHMKYEKKMARDSATILKNDKSTLPFKPKKGDTVLILAPYEEQTAAIAKTISKIRKNI
KVVEYRFAEKTFEEEIQKKIDEADYVITGSYVIKNDPVVNDGVIDDSIQDSSKWATAFPR
AAMKYAQANGKKFVLMSLRNPYDTANFEEAEAVIAVYGFKGYANGRFRQPNIPAGVEAIF
GKAKPKGTLPVDIPSVTRPGETLYPYGYGLNIKNGKPLHKGGS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatttcttcaatgcgcgttgattgcattgctgttatcgtctctcgctttgcag
ccggccgctcgcgaagcagaagcaaaacagcgtccggaacaaaacatcaaacaaatggtc
agcagcatgtcgcttgaagagaaaatcgggcaaatgctgatgcctgactttagaaactgg
aagaaaaaaggggaatcgagcgccaaaggattaacagaaatgaatgacgaagttgctgga
atcattgaaaaataccggctcgggggcgtcattctttttgctgaaaacgtcacaggcaca
gagcagactgtacggttaacggacggcctgcaacaagcgagccctgacattccgctcttt
atcacgatcgatcaggaaggcgggattgtcacgagactcgaatcaggcacaaacctggcc
ggcaatatggcagtcggagcatcgagaagcagcaaaaacgccttcagatcaggaaaaatc
atcggaaaagaattatcatcactgggcattaacgtgaatttcagtcctgtacttgatgtc
aacaacaatcccgacaaccctgtcatcggcgtccgttctttcagttccaagcctgagctg
acttcaaagctcggcatccagatgatgaagggccttcaggacgagcaaatgatcgccaca
gcaaagcactttcccggacacggcgatacagcggttgacagtcattacggattgccgctt
gttccgcataatgaaaaaaggctgagaagtgttgaacttgcgccatttcaaaaggcgatc
gatgcaggtattgacatgatcatgacagcgcatgtccagttccccgcctttgacgatact
acctataaaagcaaaaaagacggcgaggacatcatggtgcctgctacgctttccaaaaaa
gtcatgacagaccttctccgcaaagatctcagctttaagggcgttgttgtaacagacgct
ttaaatatgaaagccatttctgataatttcggacaggaggaagccgtcgtcatggctgtt
aaagcaggagtcgacatcgcactcatgcccgcgcaagtcacatcgcttgagaccgaaaaa
aatctggcgcgtgtattcgaagctcttctgacagccgttaaaaatggggatatccccatg
gaacaaatcgatcagtcggtggagcgaatccttcaattaaaaatagaccgaggcatcata
gatcacaccggctccgaaccgcttcagaaaaaaatcaaatacgccttgaaaacggtcggc
agcagcaaacacatgaaatacgaaaagaaaatggcaagggatagcgccactatccttaaa
aacgacaaaagcaccctgccgtttaaaccgaaaaaaggggacaccgtcctcattctcgct
ccatatgaagagcaaacagcagcaatcgcaaagaccatcagcaaaataaggaaaaacatc
aaggtagtcgaataccgctttgcagaaaaaacgtttgaggaagagattcaaaagaaaatt
gacgaagccgattatgtcatcacaggatcatacgtcatcaaaaacgatccggttgtgaac
gacggtgtcattgatgacagcattcaagactcaagcaagtgggcaaccgcttttccgcgc
gccgccatgaaatacgcgcaggccaacggaaaaaaattcgtcttaatgagcctgagaaac
ccttatgacacggcaaattttgaagaagccgaagccgtgattgcggtatacggctttaaa
ggctatgcaaacggacgcttcaggcagccgaatatcccggccggagtggaagccattttc
ggaaaggcaaagcctaaaggaacattgcccgtagacattccttcagtcacgcgccccggg
gaaaccctttacccgtatggctacggattgaatattaaaaacggcaagccgcttcacaaa
ggagggtcatga

DBGET integrated database retrieval system