KEGG   Bacillus licheniformis ATCC 14580: BL02770Help
Entry
BL02770           CDS       T00197                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BL02770 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL02770 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BL02770 (trpA)
Enzymes [BR:bli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BL02770 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342343..2343146)
Genome map
AA seq 267 aa AA seqDB search
MFNLKKQPSDKLFVPFITAGDPLPEISIELAKSLQEAGASALELGVPYSDPLADGPVIQR
ASKRALDNDMNIVKAIRLGGEMKKNGVHIPIILFTYYNPVLQLDTDHFFALLRQNQLDGL
LVPDLPFEESVYLQQQCKKHGITYISLVAPTSESRIQKITQQAEGFVYCVSSLGVTGVRN
EFEDSVSSFIRSVKGMSSVPVAVGFGISSSKQVEMMNELADGVVVGSALVRKIEELKDEL
VAPETREQALKAFEAYAKTFSGSYMVK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatctgaaaaaacagccgtccgataagctatttgttccgtttattacagcggga
gacccgctgccagaaatctcgatcgagctggcaaaatctcttcaagaggcgggagcgtcc
gcccttgaactcggggttccgtattctgatccgctcgctgacggcccggtgattcagcgc
gcatcaaaaagggcgcttgacaacgatatgaacatcgtaaaagcgatcaggcttggcggt
gaaatgaaaaaaaacggcgtccatattccgattattctctttacgtattataatcctgtg
ttacaattagatacagatcactttttcgctttactgcgacaaaatcagctagacggactc
cttgtaccggaccttccttttgaggaaagcgtatatttgcagcagcagtgtaaaaaacac
gggattacctatatttcgctggtcgcgccgacaagcgaatcgcgcattcaaaaaataacg
cagcaggcggaaggttttgtgtattgcgtttcttcgctcggtgtcacaggtgtgcgcaat
gaattcgaagattctgtttcttcatttatcaggtctgttaaaggaatgagctccgtcccg
gttgccgtcgggtttgggatttccagctccaaacaagtggagatgatgaatgaactggcg
gacggcgttgtcgtgggaagcgcccttgtcagaaagatcgaggagctgaaagacgaactc
gtcgcccctgagacaagggaacaagccttaaaggcgtttgaggcatacgctaagacattt
agcggatcgtacatggtaaaatga

DBGET integrated database retrieval system