KEGG   Bacillus licheniformis ATCC 14580: BL02771Help
Entry
BL02771           CDS       T00197                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BL02771 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL02771 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BL02771 (trpB)
Enzymes [BR:bli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BL02771 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2343115..2344341)
Genome map
AA seq 408 aa AA seqDB search
MYSYPNEQGRFGDFGGKFVPETLMQPLEEIEKAFLELKDDPSFQKDYQKLLNDYSGRPTA
LTFADQLTKQLGGAKIYLKREDLNHTGAHKINNALGQALLAKKMGKTKLIAETGAGQHGV
AAATVAAKFGLSCIVFMGEEDVARQSLNVFRMKLLGAEVVPVSSGNGTLKDATNEAIRYW
VQHCQDHFYMIGSVVGPHPYPYIVREFQRMIGEEAKAQFYQLEQSLPDKVVACVGGGSNA
IGMFSAFIEETVELIGVEAAGKGVDTPLHAATITKGTKGVIHGSLTYLIQDEYGQIIEPY
SISAGLDYPGVGPEHAHLHQTGRVTYESVTDDEAVSALRLLTETEGILPAIESAHALAKA
FEIAKELPREKSVLVCLSGRGDKDVHTLMKVLEEEVNQDVQSEKTAVR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtattcatatccgaatgaacaaggcaggtttggtgattttggcgggaaattcgtcccg
gaaacactcatgcagcctttggaagaaatcgaaaaagcgtttcttgaactgaaagacgac
ccttcatttcaaaaggattatcaaaagcttttaaatgactactcaggcaggccgacggct
ttgacgttcgcagaccagctcactaagcagctgggcggagcgaagatttacttaaaaaga
gaagatttaaaccatacaggcgcccacaaaatcaacaatgccctcggccaggcgctcctg
gccaagaaaatgggaaaaacaaagctcattgctgaaaccggtgcaggccagcacggtgtg
gcggcggcgactgtcgccgcgaagttcggcttatcatgcatcgtcttcatgggggaggaa
gatgttgccagacaatcgctgaacgtgttccggatgaagctcttgggagcggaggtcgtc
ccggtgtcaagcggaaacgggacattaaaagatgctacaaacgaagcgatccgctactgg
gttcagcattgccaggaccatttttacatgatcggttccgtcgtcgggccgcatccgtat
ccttatatcgtccgcgaatttcaacggatgatcggcgaagaggcgaaagcgcagttttat
caattggagcaaagcctccccgataaagttgtcgcctgtgtcggaggcggaagcaatgcg
atcgggatgttcagcgcgttcattgaagaaactgttgaactgatcggagtcgaagctgcg
ggaaaaggtgttgacacacctcttcatgcggccacgatcacaaagggtacaaaaggcgtc
atccacggttctttgacctacttgattcaagacgagtacggacagatcatcgagccttat
tccatctcagccggacttgattatccgggagtcggccccgagcacgcccatcttcatcaa
acagggcgcgtcacgtatgaatctgtcacagatgatgaagcggtctcggcattaaggctg
ctgacagagactgagggcattttgccggctattgaatccgcccatgcattggcaaaagca
tttgaaatcgctaaagaactgccgagagagaaaagcgttctcgtctgcctttcaggcagg
ggagacaaagacgtccataccttgatgaaggtgttggaagaagaggtgaatcaagatgtt
caatctgaaaaaacagccgtccgataa

DBGET integrated database retrieval system