KEGG   Bacillus licheniformis ATCC 14580: BL02771Help
Entry
BL02771           CDS       T00197                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bli01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bli00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bli00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2343115..2344341)
Genome map
AA seq 408 aa AA seqDB search
MYSYPNEQGRFGDFGGKFVPETLMQPLEEIEKAFLELKDDPSFQKDYQKLLNDYSGRPTA
LTFADQLTKQLGGAKIYLKREDLNHTGAHKINNALGQALLAKKMGKTKLIAETGAGQHGV
AAATVAAKFGLSCIVFMGEEDVARQSLNVFRMKLLGAEVVPVSSGNGTLKDATNEAIRYW
VQHCQDHFYMIGSVVGPHPYPYIVREFQRMIGEEAKAQFYQLEQSLPDKVVACVGGGSNA
IGMFSAFIEETVELIGVEAAGKGVDTPLHAATITKGTKGVIHGSLTYLIQDEYGQIIEPY
SISAGLDYPGVGPEHAHLHQTGRVTYESVTDDEAVSALRLLTETEGILPAIESAHALAKA
FEIAKELPREKSVLVCLSGRGDKDVHTLMKVLEEEVNQDVQSEKTAVR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtattcatatccgaatgaacaaggcaggtttggtgattttggcgggaaattcgtcccg
gaaacactcatgcagcctttggaagaaatcgaaaaagcgtttcttgaactgaaagacgac
ccttcatttcaaaaggattatcaaaagcttttaaatgactactcaggcaggccgacggct
ttgacgttcgcagaccagctcactaagcagctgggcggagcgaagatttacttaaaaaga
gaagatttaaaccatacaggcgcccacaaaatcaacaatgccctcggccaggcgctcctg
gccaagaaaatgggaaaaacaaagctcattgctgaaaccggtgcaggccagcacggtgtg
gcggcggcgactgtcgccgcgaagttcggcttatcatgcatcgtcttcatgggggaggaa
gatgttgccagacaatcgctgaacgtgttccggatgaagctcttgggagcggaggtcgtc
ccggtgtcaagcggaaacgggacattaaaagatgctacaaacgaagcgatccgctactgg
gttcagcattgccaggaccatttttacatgatcggttccgtcgtcgggccgcatccgtat
ccttatatcgtccgcgaatttcaacggatgatcggcgaagaggcgaaagcgcagttttat
caattggagcaaagcctccccgataaagttgtcgcctgtgtcggaggcggaagcaatgcg
atcgggatgttcagcgcgttcattgaagaaactgttgaactgatcggagtcgaagctgcg
ggaaaaggtgttgacacacctcttcatgcggccacgatcacaaagggtacaaaaggcgtc
atccacggttctttgacctacttgattcaagacgagtacggacagatcatcgagccttat
tccatctcagccggacttgattatccgggagtcggccccgagcacgcccatcttcatcaa
acagggcgcgtcacgtatgaatctgtcacagatgatgaagcggtctcggcattaaggctg
ctgacagagactgagggcattttgccggctattgaatccgcccatgcattggcaaaagca
tttgaaatcgctaaagaactgccgagagagaaaagcgttctcgtctgcctttcaggcagg
ggagacaaagacgtccataccttgatgaaggtgttggaagaagaggtgaatcaagatgtt
caatctgaaaaaacagccgtccgataa

DBGET integrated database retrieval system