KEGG   Bacillus licheniformis ATCC 14580: BL02771Help
Entry
BL02771           CDS       T00197                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase (beta subunit)
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00260  Glycine, serine and threonine metabolism
bli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01130  Biosynthesis of antibiotics
bli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL02771 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BL02771 (trpB)
Enzymes [BR:bli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BL02771 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AAU23925
UniProt: Q65I35
Position
complement(2343115..2344341)
Genome map
AA seq 408 aa AA seqDB search
MYSYPNEQGRFGDFGGKFVPETLMQPLEEIEKAFLELKDDPSFQKDYQKLLNDYSGRPTA
LTFADQLTKQLGGAKIYLKREDLNHTGAHKINNALGQALLAKKMGKTKLIAETGAGQHGV
AAATVAAKFGLSCIVFMGEEDVARQSLNVFRMKLLGAEVVPVSSGNGTLKDATNEAIRYW
VQHCQDHFYMIGSVVGPHPYPYIVREFQRMIGEEAKAQFYQLEQSLPDKVVACVGGGSNA
IGMFSAFIEETVELIGVEAAGKGVDTPLHAATITKGTKGVIHGSLTYLIQDEYGQIIEPY
SISAGLDYPGVGPEHAHLHQTGRVTYESVTDDEAVSALRLLTETEGILPAIESAHALAKA
FEIAKELPREKSVLVCLSGRGDKDVHTLMKVLEEEVNQDVQSEKTAVR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtattcatatccgaatgaacaaggcaggtttggtgattttggcgggaaattcgtcccg
gaaacactcatgcagcctttggaagaaatcgaaaaagcgtttcttgaactgaaagacgac
ccttcatttcaaaaggattatcaaaagcttttaaatgactactcaggcaggccgacggct
ttgacgttcgcagaccagctcactaagcagctgggcggagcgaagatttacttaaaaaga
gaagatttaaaccatacaggcgcccacaaaatcaacaatgccctcggccaggcgctcctg
gccaagaaaatgggaaaaacaaagctcattgctgaaaccggtgcaggccagcacggtgtg
gcggcggcgactgtcgccgcgaagttcggcttatcatgcatcgtcttcatgggggaggaa
gatgttgccagacaatcgctgaacgtgttccggatgaagctcttgggagcggaggtcgtc
ccggtgtcaagcggaaacgggacattaaaagatgctacaaacgaagcgatccgctactgg
gttcagcattgccaggaccatttttacatgatcggttccgtcgtcgggccgcatccgtat
ccttatatcgtccgcgaatttcaacggatgatcggcgaagaggcgaaagcgcagttttat
caattggagcaaagcctccccgataaagttgtcgcctgtgtcggaggcggaagcaatgcg
atcgggatgttcagcgcgttcattgaagaaactgttgaactgatcggagtcgaagctgcg
ggaaaaggtgttgacacacctcttcatgcggccacgatcacaaagggtacaaaaggcgtc
atccacggttctttgacctacttgattcaagacgagtacggacagatcatcgagccttat
tccatctcagccggacttgattatccgggagtcggccccgagcacgcccatcttcatcaa
acagggcgcgtcacgtatgaatctgtcacagatgatgaagcggtctcggcattaaggctg
ctgacagagactgagggcattttgccggctattgaatccgcccatgcattggcaaaagca
tttgaaatcgctaaagaactgccgagagagaaaagcgttctcgtctgcctttcaggcagg
ggagacaaagacgtccataccttgatgaaggtgttggaagaagaggtgaatcaagatgtt
caatctgaaaaaacagccgtccgataa

DBGET integrated database retrieval system