KEGG   Bacillus licheniformis ATCC 14580: BL02786Help
Entry
BL02786           CDS       T00197                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BL02786 (folE)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BL02786 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2355570..2356139)
Genome map
AA seq 189 aa AA seqDB search
MREINKDQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFAGLNEDPKEHFKTIFG
EDHEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPKGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIADSIVETLTPHGVMVVVEAEHMCMTMRGVKKPGSKTVTSAVRGTFRQDVAARS
EVLELIKTS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatcaacaaagaccaaattgaacaagccgtccggcaaatattggaggcgatc
ggagaagatccgaaccgcgagggccttcttgatacaccgaaaagagtcgcaaagatgtac
gctgaagtatttgcgggtttaaacgaagatccgaaagagcatttcaaaacgattttcggc
gaggatcacgaagagcttgttcttgttaaagatattcctttttattcaatgtgtgagcac
catttagttcctttctacgggaaagcccatgtagcctatatccctaaaggcggaaaagtg
acaggactcagcaagttggcgagagccgttgaagcggtggcaaaacgtccgcagcttcag
gagcggattacgtcaacaattgccgacagcattgttgaaacgctgactccgcacggtgta
atggtggttgttgaagccgagcatatgtgcatgacgatgcgcggcgtgaaaaagccgggt
tcaaaaactgtcacttcagctgtaaggggaacgtttagacaggatgtggctgctcgctct
gaggtgttggagcttatcaaaacatcatga

DBGET integrated database retrieval system