KEGG   Bacillus licheniformis ATCC 14580: BL02786Help
Entry
BL02786           CDS       T00197                                 

Gene name
mtrA
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00790  Folate biosynthesis
bli01100  Metabolic pathways
Module
bli_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BL02786 (mtrA)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BL02786 (mtrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AAU23940
UniProt: Q65I21
Position
complement(2355570..2356139)
Genome map
AA seq 189 aa AA seqDB search
MREINKDQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFAGLNEDPKEHFKTIFG
EDHEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPKGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIADSIVETLTPHGVMVVVEAEHMCMTMRGVKKPGSKTVTSAVRGTFRQDVAARS
EVLELIKTS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatcaacaaagaccaaattgaacaagccgtccggcaaatattggaggcgatc
ggagaagatccgaaccgcgagggccttcttgatacaccgaaaagagtcgcaaagatgtac
gctgaagtatttgcgggtttaaacgaagatccgaaagagcatttcaaaacgattttcggc
gaggatcacgaagagcttgttcttgttaaagatattcctttttattcaatgtgtgagcac
catttagttcctttctacgggaaagcccatgtagcctatatccctaaaggcggaaaagtg
acaggactcagcaagttggcgagagccgttgaagcggtggcaaaacgtccgcagcttcag
gagcggattacgtcaacaattgccgacagcattgttgaaacgctgactccgcacggtgta
atggtggttgttgaagccgagcatatgtgcatgacgatgcgcggcgtgaaaaagccgggt
tcaaaaactgtcacttcagctgtaaggggaacgtttagacaggatgtggctgctcgctct
gaggtgttggagcttatcaaaacatcatga

DBGET integrated database retrieval system