KEGG   Bacillus licheniformis ATCC 14580: BL02786Help
Entry
BL02786           CDS       T00197                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bli00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2355570..2356139)
Genome map
AA seq 189 aa AA seqDB search
MREINKDQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFAGLNEDPKEHFKTIFG
EDHEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPKGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIADSIVETLTPHGVMVVVEAEHMCMTMRGVKKPGSKTVTSAVRGTFRQDVAARS
EVLELIKTS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatcaacaaagaccaaattgaacaagccgtccggcaaatattggaggcgatc
ggagaagatccgaaccgcgagggccttcttgatacaccgaaaagagtcgcaaagatgtac
gctgaagtatttgcgggtttaaacgaagatccgaaagagcatttcaaaacgattttcggc
gaggatcacgaagagcttgttcttgttaaagatattcctttttattcaatgtgtgagcac
catttagttcctttctacgggaaagcccatgtagcctatatccctaaaggcggaaaagtg
acaggactcagcaagttggcgagagccgttgaagcggtggcaaaacgtccgcagcttcag
gagcggattacgtcaacaattgccgacagcattgttgaaacgctgactccgcacggtgta
atggtggttgttgaagccgagcatatgtgcatgacgatgcgcggcgtgaaaaagccgggt
tcaaaaactgtcacttcagctgtaaggggaacgtttagacaggatgtggctgctcgctct
gaggtgttggagcttatcaaaacatcatga

DBGET integrated database retrieval system