KEGG   Bacillus licheniformis ATCC 14580: BL03300Help
Entry
BL03300           CDS       T00197                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BL03300 (dfrA)
   00670 One carbon pool by folate
    BL03300 (dfrA)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BL03300 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2269836..2270324)
Genome map
AA seq 162 aa AA seqDB search
MISLIAAMDRNRLIGKDNDLPWHLPQDLKYFKEVTKGHAVIMGRKTFESIGRPLPHRENI
IVTSNKELDIPNCQVMHSAEEAVRFAKNRNEECFVIGGSTLYTEILPFADKLYVTKIDET
FEGDRYFPEFSEAEWEIVSRRKGLKDDKNPYDYEFLVYQRKG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatctcattgattgctgcaatggacagaaaccgcctgatcggcaaagacaatgatttg
ccatggcatctgccgcaagatttgaagtattttaaagaggtgacgaaagggcacgccgta
atcatggggagaaagacgttcgagtccatcggcagacctttgccccaccgcgagaacatc
atcgtcacatccaataaagaactggatatcccgaattgtcaggtgatgcactcggcagag
gaagcggtgcggtttgcgaaaaacagaaacgaagaatgttttgtcatcggcggttcaaca
ctatacacggagattctgccttttgcggacaagctgtatgtgacaaaaattgatgaaacc
tttgaaggggaccggtactttcctgaattcagcgaagctgagtgggaaatcgtttcgagg
cggaaaggcctgaaagatgacaaaaatccttatgactacgaattcctcgtttatcaaaga
aaaggatag

DBGET integrated database retrieval system