KEGG   Bacillus licheniformis ATCC 14580: BL03408Help
Entry
BL03408           CDS       T00197                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bli01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bli00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3559490..3560770)
Genome map
AA seq 426 aa AA seqDB search
MKIKSISGNTSVSLKRSIDAGTEEQRKAVRGIIEEVKKNGNAAVSAFTRQFDGADVAGFR
VSEEEIKEAYSALEERDLEIIQAAIFNIKEYHERQLATSWFYHRKDGTMLGQKITPLDSA
GVYVPGGTAAYPSSVLMNVIPALVAGVDRIVLASPPGKDGKLSAGVLAAAAELGVTEIYK
MGGAQAIAALAYGTETITPVDKITGPGNIYVALAKREVFGQVDIDMIAGPSEIAILADST
ANYREIAADLLSQAEHDAMASSILVTDSETLAESVLKEVYRQLEHLPRKEIARQSIDNYG
LIYVTETMNEAVSVINELAPEHLEILTVQPDALLGQIKHAGAIFLGRYSSEPVGDYFAGP
NHVLPTNGTARFSSPLNVTDFQKRSSIISYSREAFRANAEKIAAFARLEGLEAHARAIES
RNREED
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaaatccatcagcggaaatacgtcggtttcactaaaacgctctattgacgcc
ggaacggaggaacaaagaaaagcagtccgcggcattatcgaagaagtgaaaaagaacgga
aatgcagctgtttccgcattcacaagacaatttgacggagcggatgtggccggctttcgc
gtttccgaagaggaaatcaaggaagcatacagcgcgctcgaagaacgtgatctcgagatt
attcaggcggcgattttcaacattaaagaatatcatgagcgtcagctcgcaacatcttgg
ttttaccaccgcaaggacggaacgatgctcggccaaaaaattacgccgcttgattcagcg
ggggtgtatgtgcccggcggaacggctgcttacccatcatccgttctgatgaatgtcatt
ccggcgcttgttgcaggcgtcgaccgcattgtccttgcctcacctccgggaaaagacggt
aaattgtcggcgggagtgctggctgctgctgcggagcttggcgtcacagagatttacaaa
atgggcggtgcccaagcgattgccgcattggcttacggaacggaaacgattacccccgtc
gataaaattacgggacccggaaatatttacgtcgccttggctaaacgggaagtattcggc
caggttgatatcgatatgatcgcgggtccaagtgaaatcgccatactcgctgacagtacg
gcaaactaccgggaaatcgccgcagatctactttcacaggctgaacacgatgcgatggca
tcgagcattcttgtcaccgattcagagacgcttgccgaatccgttttaaaagaggtttac
agacagctcgaacatcttccgagaaaagagattgcacggcagtcgattgacaactatggc
ctgatctatgttacagagacgatgaatgaagcagtttccgtcatcaatgagctcgctcct
gaacatttggaaattttaacagttcaacccgatgcgctgctgggacagatcaaacatgcg
ggcgccattttcctgggccgctacagttcagagccggtgggcgattattttgcaggccct
aatcatgtcctgccgactaacggtacagccagattttcaagcccgctaaatgtgacagac
ttccaaaagcgctccagcatcatttcctacagcagggaagctttccgcgcgaatgctgag
aaaattgcggcctttgccagattggaagggcttgaagcccatgcaagagcaattgaatcc
agaaaccgggaggaagactga

DBGET integrated database retrieval system