KEGG   Bacillus licheniformis ATCC 14580: BL03481Help
Entry
BL03481           CDS       T00197                                 

Gene name
yvaK
Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3472688..3473434)
Genome map
AA seq 248 aa AA seqDB search
MKIVKPQPFTFKGGKKAVLLLHGFTGNTADVRMLGRYLNEKGYTCHAPQYKGHGVPPEEL
LSTGPEDWWKDVMDGYEYLKSEGYEQIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMYI
KSEETMYEGVLDYARNYKKFEGKTAEQINAEMEEFKKTPMNTLKALQDLIADVREHVDMI
YSPTFVVQARHDHMINTDSANIIYNEVETDDKQLKWYEESGHAITLDKERETLHKDVYQF
LETLDWQT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcaaaccacaacctttcacatttaaaggcggaaaaaaagccgtcctgctg
ctgcacggatttacgggcaacacggcggacgttagaatgctcggaagatatttgaatgaa
aaaggctacacatgccatgcgccccaatataaaggccacggcgtgcctccagaagaactt
ctctccacaggaccggaagactggtggaaagacgtcatggacggatatgaatatctgaaa
tcggaaggatatgaacaaatcgccgcttgcggactgtctctcggaggggttttttcattg
aaattgggttacactgtacccataaagggaattgttccaatgtgcgcgccgatgtacatc
aaaagcgaagagacgatgtacgagggtgtgcttgattatgcccgcaattataagaaattt
gaaggcaagacagcggagcagattaacgctgagatggaagaattcaaaaaaacgccgatg
aacacgttgaaagcactgcaggatttgattgccgatgtcagagagcatgtggacatgatc
tattcgcctacatttgtcgtgcaggcgcgccacgatcatatgattaatacggatagcgca
aacatcatctacaatgaagttgaaacggatgataagcagctgaaatggtatgaagaatca
ggtcatgccatcacattggataaagaacgcgaaacactgcacaaggatgtgtatcaattt
ttagaaacgttggattggcagacataa

DBGET integrated database retrieval system