KEGG   Bacillus licheniformis ATCC 14580: BL05004Help
Entry
BL05004           CDS       T00197                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BL05004 (folK)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BL05004 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91781..92281
Genome map
AA seq 166 aa AA seqDB search
MNNTAYIALGSNIGRREEYLKKAVSLLHQHPSVEVTDISSIYETDPVGYTDQDLFLNMAA
AVKTSLSPFELLDLTQRIEKELGRKRDIRWGPRTADLDILLYNRENIETEQLIVPHPRMH
ERLFVLIPLLEIYPDLEGAVNHAKNQEGVRVWKQKSGVDEFVHIES
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacacggcatatatagcgctcggctcgaatatcggccggcgggaagaatattta
aaaaaagctgtctctctcctccatcaacatccgtctgtagaggtgacagacatctcgtca
atttacgaaactgatcctgtcggttatacagaccaagatctatttttaaacatggctgca
gctgttaaaacatctctttcaccgtttgaattgctcgatttgactcagcgtattgaaaaa
gaactcggccgcaaacgcgacattagatgggggccgaggactgcagaccttgacattttg
ttgtataatcgtgaaaatattgagacagagcaacttatcgttcctcatcctagaatgcat
gaacgtttgtttgtactcatcccgctgctggagatttatccggatcttgagggagctgtc
aatcatgcaaaaaatcaagaaggtgtaagagtatggaagcagaaatctggggtagacgaa
ttcgtgcatatcgaaagctga

DBGET integrated database retrieval system