KEGG   Bifidobacterium longum DJO10A: BLD_0152Help
Entry
BLD_0152          CDS       T00707                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
blj00340  Histidine metabolism
blj01100  Metabolic pathways
blj01110  Biosynthesis of secondary metabolites
blj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BLD_0152 (hisD)
Enzymes [BR:blj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BLD_0152 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACD97598
UniProt: B3DQ99
Position
192052..193449
Genome map
AA seq 465 aa AA seqDB search
MSENIMRIIDLRGQNLSRAELLAAMPRAAMGTSEATDLVRPILDDVKERGAAALRDFEEK
FDHVRPKNLRVPVEAIKDALTTLDPEVRAAIEESVRRARAVAANQVPKDFYTDLAEGARV
AERWIPIQRVGLYVPGGKAVYPSSVIMNAVPAQAAGVESLAIATPPARDNEEGLPNKTIL
ATCAILGVDEVYAVGGAQAIAMFAYGAKGSEPQDGDILCDPVDKITGPGNIFVATAKSLV
SAFVGIDAVAGPTEIGIIADETANPSLLAADLIGQAEHDELAGSVLFTDSTEIVDKVQEN
LKYRVPRTEHAERVHTSLSGTQSAIVLTDGLDQSIDAANAYAAEHLEIQTKDADAVVKRI
KNAGAIFRGPYSPVPLGDYMSGSNHVLPTGGTARFAAGLGVHTFMKPVEVIEYDEEGLKA
IAARINAFAVSEDLPAHGECVLSRFVKDPYDKATLREQEKEAGLR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacatcatgcgaatcattgacctgcgtggtcagaacctgtcccgtgccgaa
ctgcttgccgcgatgccgcgtgctgcaatgggtacttccgaagccaccgatttggtgcgt
ccgattctggacgatgtcaaagaacgcggcgccgctgccctgcgcgacttcgaggagaag
ttcgatcacgtgcgtcccaagaacctgcgcgtgccggtcgaggcgatcaaggacgccctg
accacgctcgaccccgaagtgcgcgccgccatcgaggaatcggtgcgccgcgcccgcgcc
gtggccgccaaccaggtgccgaaggacttctacaccgacctcgccgaaggcgcccgcgtg
gccgaacgctggattccgattcagcgcgtcggcctgtatgtgcccggcggcaaggccgtc
tacccgagctccgtcatcatgaacgctgtgccggcccaggccgccggcgtcgaatcgctg
gccatcgccaccccgcccgcccgcgacaatgaggaaggcctgccgaacaagaccatcctc
gccacctgcgccatcctcggtgttgacgaggtatacgcggtcggcggcgctcaggccatc
gccatgttcgcatacggcgccaagggcagcgagccgcaggacggcgacatcctgtgcgat
ccggttgacaagatcaccggcccgggcaacatcttcgtggccaccgccaagtcactggtc
tccgcattcgtgggcattgacgcggtcgccggccccaccgaaatcggcatcatcgccgac
gaaaccgccaacccgagcctgctggccgccgacctcatcggccaggccgagcacgatgag
ctcgccggttccgtgctgttcaccgactccaccgagattgtcgacaaggtgcaggagaac
ctcaagtaccgcgtgccgcgtaccgagcacgccgagcgcgtccacacgtcgctgtccggc
acccagtctgccatcgtgctgaccgacggtcttgaccagtccatcgacgcggccaacgcc
tacgccgccgaacaccttgagattcagaccaaggatgccgatgctgtcgtcaagcgcatc
aagaacgccggtgccatcttccgcggcccgtactccccggtgccgctgggcgactacatg
tccggctccaaccacgtgctgcccaccggcggcaccgcccgcttcgccgcaggcctcggc
gtgcacaccttcatgaagccggtcgaagtcatcgaatacgacgaggaaggcctcaaggcc
atcgccgcccgtatcaacgccttcgcggtgtccgaggacctgcccgcccacggcgagtgc
gtgctctcccgcttcgtcaaggatccgtatgacaaggccaccctgcgcgagcaggagaag
gaagccggtctgcgatga

DBGET integrated database retrieval system