KEGG   Bifidobacterium longum DJO10A: BLD_0300Help
Entry
BLD_0300          CDS       T00707                                 

Gene name
rbsK1
Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLD_0300 (rbsK1)
Enzymes [BR:blj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLD_0300 (rbsK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373507..374469
Genome map
AA seq 320 aa AA seqDB search
MPEPVRERLEALKDAPGSVIVVGSMNADYTVTTKRLPKPGETVNGGAMKVLPGGKGANQA
SAAARLGVNVQLLGAVGEDSNADFLLSKLDEAGVDTADILHVEGPSGTTVITVSAEGENT
IVYSPGSNAKASAGYVQSHRTTIAECAVLGLCLESPIATVIAAAQTAHDAGVTVLLNDSP
FMDELPHELVEATDILLVNQHEVAQLLGLPDDDVESLDWYEVAERFTDYGFDRAIVTLGA
SGSVVIENGRWHRVSAAQVNAVDTTGCGDSFMGTVLAGLAAGHTLLQSAQIGSYVSAYAA
TKLGAQSAYGTAEEVIAYFS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcccgtacgggaacgattggaagcgctgaaggatgcgccgggctcggtaatc
gtggtcggctcgatgaacgccgattacaccgtaaccactaaacgactacccaagccaggt
gaaaccgtcaatggtggtgccatgaaagtgctgccgggcggcaagggcgcgaatcaggcg
tctgccgccgctcgtctcggtgtcaatgtccagttgctgggcgcggtgggcgaggactcc
aacgcggacttcctattaagcaagctggatgaggccggcgtcgacaccgccgatatcctg
catgtcgaaggccccagcggcaccacggtaatcaccgtgagcgctgagggcgagaacacc
atcgtctattcgccgggttccaatgccaaggcaagtgccggctatgtgcaatcacatcgc
acgaccatcgccgaatgcgcggtattgggactgtgtttggagagcccgattgccaccgtt
atcgccgccgcgcagaccgcgcatgacgctggcgtgaccgtgctgctcaacgactcgcca
tttatggacgagctgcctcacgaactggtggaagccacggatattctgctggtcaaccag
catgaagtggctcaactgctgggcctgccggatgatgacgtggaatcactcgactggtat
gaggtcgccgaacgattcaccgattacggattcgaccgggcgatagtgacgcttggtgcg
tcgggatcggtggtgatcgagaacggacgttggcatcgcgtatccgccgcgcaagtcaat
gcagtggacaccaccggttgcggcgactcgttcatggggaccgtgctggctggcttggcc
gccggtcatacgctgctgcaatccgcgcaaatcggctcctacgtctccgcctatgcggcc
accaagcttggtgcccaaagtgcctacggtaccgccgaagaagtcatcgcctacttcagc
tga

DBGET integrated database retrieval system