KEGG   Bifidobacterium longum DJO10A: BLD_0433Help
Entry
BLD_0433          CDS       T00707                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLD_0433 (tpiA)
   01230 Biosynthesis of amino acids
    BLD_0433 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLD_0433 (tpiA)
   00051 Fructose and mannose metabolism
    BLD_0433 (tpiA)
   00562 Inositol phosphate metabolism
    BLD_0433 (tpiA)
Enzymes [BR:blj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLD_0433 (tpiA)
Exosome [BR:blj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLD_0433 (tpiA)
  Exosomal proteins of bladder cancer cells
   BLD_0433 (tpiA)
  Exosomal proteins of melanoma cells
   BLD_0433 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518425..519228
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAKLIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVRILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSTKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttt
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtgcaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatcttggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgctcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccaaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacttttggcacgaaggtatccgatagcgtacgtatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccctggacgttgaggaactcgccaaaatcgctcgactggcactg
aaatccacgaaatcacggaactaa

DBGET integrated database retrieval system