KEGG   Bifidobacterium longum DJO10A: BLD_0452Help
Entry
BLD_0452          CDS       T00707                                 

Gene name
ruvA
Definition
Holliday junction resolvasome DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:blj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLD_0452 (ruvA)
Enzymes [BR:blj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BLD_0452 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
539984..540610
Genome map
AA seq 208 aa AA seqDB search
MIGMLTGRVESVETDTALIDVGGVGYEVRMSATDLSRLHAGQDTRVFTYMNLSQDAITLH
GFLDRDAKKTFLQLIKVSGIGPKVAQSLLSTLTPSQLAHAIADNDATALAKAPGLGKKGA
QKIILELKGSIDLSQIEGASAQAATSKSPVDTGTEQVVEGLISLGWRQQDAQQAVAEACA
ENDIPTPLATDDVPRVLRLALALMDRGR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcatgctgaccgggcgggttgaatcggtcgaaaccgataccgcattgattgat
gttgggggagtgggctacgaagtgcgcatgtccgccaccgacctgagccgtctgcacgcc
gggcaagacacccgcgtcttcacctatatgaacctctctcaggatgccattaccctgcat
ggattcctggatcgggacgccaagaaaacctttctgcaactcatcaaggtctccggcatt
gggcctaaagtggcccaatcgttactctccacactgacgccgagtcagttggcccacgcc
atcgccgacaacgacgccaccgcgctggccaaggctccggggctgggtaagaagggcgca
cagaagatcatcctcgagcttaagggctctattgatttgagtcagatcgagggtgcttcc
gctcaggcggcaacatccaagtctccggtggataccggtacggaacaggttgtcgaagga
ctgatttcgcttggctggcgtcagcaggacgcccagcaggccgttgccgaggcttgcgcc
gaaaacgacattcccacgccgcttgccaccgacgatgtgccgcgtgtgctacgtctggct
ttggcgctgatggataggggccgctga

DBGET integrated database retrieval system