KEGG   Bifidobacterium longum DJO10A: BLD_0482Help
Entry
BLD_0482          CDS       T00707                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLD_0482 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLD_0482 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLD_0482 (trpA)
Enzymes [BR:blj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLD_0482 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(568497..569366)
Genome map
AA seq 289 aa AA seqDB search
MTNEATTPSGQPLGISHKPSKSVAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFKTMVE
HGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSYWN
LVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTERLE
TVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAKVG
SYADGVIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgaagcaaccacgccgtccggccagccgctgggcatcagccacaagcccagc
aagtcggtcgctatgttcaccaagttcaaggccgagaacaagcctgccttcatcggctac
ctgccctacggcttccccaacccggacgtctcgcttgacgccttcaagacgatggtcgag
cacggcgtcgacgccgtggagatcggcctgccgtactccgacccggtcatggacggcccg
gtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgcgtgttc
gaggccgtcgaaaccgtggccaacgccggcggcgtgccgctcatcatgagctactggaac
ctcgtgtaccactacggcgtcgagcgtttcgcccgcgacttcgagaacgccggcggcgcc
ggcctcatcaccccggacctcatcccggacgaggcgggggagtggatcgaagcctccgac
cgtcacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgcctcgaa
accgtggcccgcaacgcgcgcggcttcgtgtatgcggccgcccgcatgggcgtcaccggc
gaacgcgccaccatcgacgcctcgcccgaactcctcgtggagcgcacccgtcaggccggt
gccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaaggtcggc
tcctacgcggacggcgtcatcgtcggctccgcgctcgtgcacaccctgctcgcggacgac
aacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagcgaggaa
ctggccgaaggcatccacaacgcccggtga

DBGET integrated database retrieval system