KEGG   Bifidobacterium longum DJO10A: BLD_0482Help
Entry
BLD_0482          CDS       T00707                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
blj00260  Glycine, serine and threonine metabolism
blj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blj01100  Metabolic pathways
blj01110  Biosynthesis of secondary metabolites
blj01130  Biosynthesis of antibiotics
blj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLD_0482 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLD_0482 (trpA)
Enzymes [BR:blj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLD_0482 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: ACD97928
UniProt: B3DS09
Position
complement(568497..569366)
Genome map
AA seq 289 aa AA seqDB search
MTNEATTPSGQPLGISHKPSKSVAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFKTMVE
HGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSYWN
LVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTERLE
TVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAKVG
SYADGVIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgaagcaaccacgccgtccggccagccgctgggcatcagccacaagcccagc
aagtcggtcgctatgttcaccaagttcaaggccgagaacaagcctgccttcatcggctac
ctgccctacggcttccccaacccggacgtctcgcttgacgccttcaagacgatggtcgag
cacggcgtcgacgccgtggagatcggcctgccgtactccgacccggtcatggacggcccg
gtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgcgtgttc
gaggccgtcgaaaccgtggccaacgccggcggcgtgccgctcatcatgagctactggaac
ctcgtgtaccactacggcgtcgagcgtttcgcccgcgacttcgagaacgccggcggcgcc
ggcctcatcaccccggacctcatcccggacgaggcgggggagtggatcgaagcctccgac
cgtcacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgcctcgaa
accgtggcccgcaacgcgcgcggcttcgtgtatgcggccgcccgcatgggcgtcaccggc
gaacgcgccaccatcgacgcctcgcccgaactcctcgtggagcgcacccgtcaggccggt
gccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaaggtcggc
tcctacgcggacggcgtcatcgtcggctccgcgctcgtgcacaccctgctcgcggacgac
aacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagcgaggaa
ctggccgaaggcatccacaacgcccggtga

DBGET integrated database retrieval system