KEGG   Bifidobacterium longum DJO10A: BLD_0483Help
Entry
BLD_0483          CDS       T00707                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLD_0483 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLD_0483 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLD_0483 (trpB)
Enzymes [BR:blj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLD_0483 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(569390..570349)
Genome map
AA seq 319 aa AA seqDB search
MGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQALNVARMRMLGAEVVEVT
LGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDFQKIIGEEAKQQLQDWY
GIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPESGKHAIRFAPGTGQLG
MFQGTKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGRVNYSWATDEEAMNAFR
DLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISGRGDKDMAAAGKWFGYL
TDDQAAALDVAGAHGNTVA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacccgcgtgatcgccgagaccggcgccggccagcacggcgtggccaccgcc
accgtgtgcgccatgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgc
cgtcaggccctcaacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgacc
cttggcgacaagatcctgaaggacgccatcaacgaagccctgcgcgactgggtcaccaac
gtcaaggacacgcactacctgctcggcaccgtcgcgggcccgcacccgttcccggccatg
gtgcgcgacttccagaagatcatcggcgaggaagccaagcagcagctccaggactggtac
ggcatcgaccatccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggc
gtgatgaacgccttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggc
aacggccccgaatccggcaagcacgccatccgcttcgcccccggcaccggccagctcggc
atgttccagggcaccaagagctacctgctggaaaccgacgaaggccagacgctcgacacc
tactcgatctccgcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaag
gacatcggccgcgtgaactacagctgggccaccgacgaggaggccatgaacgccttccgc
gacctgagccagaccgagggcatcatccccgccatcgaaagctcgcacgccgtggccggc
gcgtacaaggccgccgccgatctgaaagccaagggctatgacaaggccgtgatgatcgtg
aacatctccggccgaggcgacaaggacatggccgccgccggcaagtggttcggctacctg
accgacgatcaggccgccgcgctcgatgtggccggcgcccacggcaatactgtcgcctga

DBGET integrated database retrieval system