KEGG   Bifidobacterium longum DJO10A: BLD_0483Help
Entry
BLD_0483          CDS       T00707                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLD_0483 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLD_0483 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLD_0483 (trpB)
Enzymes [BR:blj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLD_0483 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(569390..570349)
Genome map
AA seq 319 aa AA seqDB search
MGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQALNVARMRMLGAEVVEVT
LGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDFQKIIGEEAKQQLQDWY
GIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPESGKHAIRFAPGTGQLG
MFQGTKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGRVNYSWATDEEAMNAFR
DLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISGRGDKDMAAAGKWFGYL
TDDQAAALDVAGAHGNTVA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacccgcgtgatcgccgagaccggcgccggccagcacggcgtggccaccgcc
accgtgtgcgccatgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgc
cgtcaggccctcaacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgacc
cttggcgacaagatcctgaaggacgccatcaacgaagccctgcgcgactgggtcaccaac
gtcaaggacacgcactacctgctcggcaccgtcgcgggcccgcacccgttcccggccatg
gtgcgcgacttccagaagatcatcggcgaggaagccaagcagcagctccaggactggtac
ggcatcgaccatccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggc
gtgatgaacgccttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggc
aacggccccgaatccggcaagcacgccatccgcttcgcccccggcaccggccagctcggc
atgttccagggcaccaagagctacctgctggaaaccgacgaaggccagacgctcgacacc
tactcgatctccgcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaag
gacatcggccgcgtgaactacagctgggccaccgacgaggaggccatgaacgccttccgc
gacctgagccagaccgagggcatcatccccgccatcgaaagctcgcacgccgtggccggc
gcgtacaaggccgccgccgatctgaaagccaagggctatgacaaggccgtgatgatcgtg
aacatctccggccgaggcgacaaggacatggccgccgccggcaagtggttcggctacctg
accgacgatcaggccgccgcgctcgatgtggccggcgcccacggcaatactgtcgcctga

DBGET integrated database retrieval system