KEGG   Bifidobacterium longum DJO10A: BLD_0635Help
Entry
BLD_0635          CDS       T00707                                 

Gene name
pncA
Definition
Nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:blj00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723277..723891
Genome map
AA seq 204 aa AA seqDB search
MTKALIVVDVQPTFCESGELGVAGGNAVAERIADYVNAHRSEYAYIATTQDWHIEPGAHW
SAEPDFVDTWPKHGAAGTLNAELHPAIKALNIEHHFKKGQYSAAYSGFEGIEDNTDRIQT
REEVEAEQSAGKTLANALKAAGVSRVDVVGIAESHCVKDTALDAKKLGFEVTVFEDLTVP
VSEELGVAARKQMAAGGITLAESR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcactgattgtggtggatgtgcagccgacgttctgtgaaagcggcgaactg
ggtgtcgcaggcggcaacgcggtcgccgagcggattgccgattatgtgaacgcgcatcgc
agcgagtacgcgtatatcgcaaccacgcaggactggcatatcgagccgggcgcgcactgg
tcggcggagccggatttcgtggacacgtggccgaagcatggtgcggccggcacgctgaac
gccgaattgcatccggcgatcaaggcgctgaatatcgagcatcatttcaagaagggccag
tattcggcggcatattccggttttgagggtatcgaggacaataccgaccgtatccagacc
cgcgaggaggtcgaggccgagcaatccgccggcaagacgctggccaacgcgctgaaggcc
gccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcgcattgtgtcaaggacacc
gcgctcgatgccaagaagctcggcttcgaggtcaccgtgttcgaggatctgaccgtgccg
gtcagcgaggaacttggtgttgcggcccgcaagcagatggctgcgggcggcatcacattg
gctgagtcccgctga

DBGET integrated database retrieval system