KEGG   Bifidobacterium longum DJO10A: BLD_0729Help
Entry
BLD_0729          CDS       T00707                                 

Gene name
lacZ1
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLD_0729 (lacZ1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BLD_0729 (lacZ1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BLD_0729 (lacZ1)
Enzymes [BR:blj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLD_0729 (lacZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
835142..838213
Genome map
AA seq 1023 aa AA seqDB search
MTDVTHVDRASQAWLTDPTVFEVNRTPAHSSHKWYARDPQSGQWSDLKQSLDGEWRVEVV
QAADINLEEEPATAESFDDSSFERIQVPGHLQTAGLMNHKYVNVQYPWDGHENPLEPNIP
ENNHVALYRRKFTVSAPVANAKQAGGSVSIVFHGMATAIYVWVNGAFVGYGEDGFTPNEF
DITELLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELAARPHVHIENTQIEADW
DPEAGTASLDAALTVLNAADAATVRATLKDADGNTVWQTTGDAEAQTAISSGPLQGIAPW
SAESPTLYELDVDVIDQAGDVIECTSQKVGFRRFRIEDGILTINGKRIVFKGADRHEFDA
ERGRAITEQDMIDDVVFCKRHNINSIRTSHYPNQERWYELCDEYGIYLIDETNLEAHGSW
SLPGDVLTEDTIVPGSKREWEGACVDRVNSMMRRDYNHPSVLIWSLGNESYVGDVFRAMY
KHVHDIDPNRPVHYEGVTHNRDYDDVTDIETRMYSHADEIEKYLKDDPKKPYLSCEYMHA
MGNSVGNMDEYTALERYPKYQGGFIWDFIDQAIYATQPDGTRSLRYGGDFGDRPSDYEFS
GDGLLFADRKPSPKAQEVKQLYSNVHIDVTKDSVSVKNDNLFTATGDYVFVLSILADGKP
VWQSTRRFDVPAGETRTFDVAWPVAAYRADARELVLQVSQHLAKATDWAESGYELAFGQT
VVPADATATPDTKPADGTITVGRWNAGVRGAGREVLLSRTQGGMVSYTFAGNEFVLRRPA
ITTFRPLTDNDRGAGHGFERVQWLGAGRYARCVDNVLEQIDDSTLKGTYTYELATAQRTK
VTVSYTAHTDGRVNLHVEYPGEQGDLPTIPAFGIEWTLPVQYTNLRFFGTGPEETYLDRK
HAKLGVWSTNAFADHAPYLMPQETGNHEDVRWAEITDDHGHGMRVSRADGAAPFAVSLLP
YSSFMLEEAQHQDELPKPKHMFLRVLAAQMGVGGDDSWMSPVHPQYHIPADKPISLDVDL
ELI
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcacacatgtcgatcgcgcatcgcaggcttggctgaccgacccgacggtg
ttcgaggtgaaccggactccggcccattccagccacaagtggtacgcccgcgacccccag
agcggacaatggtccgatctcaagcagagccttgacggcgagtggcgggtcgaggtcgtt
caggccgccgacatcaacctcgaagaggaacccgcgacggccgagtcgttcgacgactcc
tcgttcgagcgtatccaggttccgggccacctgcagacggccggtctgatgaaccacaag
tacgtgaacgtccagtatccgtgggacggccacgagaacccgttggaaccgaacatcccg
gagaacaatcacgtcgcgctctaccgcaggaagttcaccgtctccgcccccgtggcaaac
gccaagcaggccggcggatcggtgtcgatcgtgttccacggcatggccacggcgatctac
gtgtgggtcaacggcgcgttcgtcggctatggcgaggacggcttcacgcccaatgagttc
gacatcaccgaactgctgcacgacggggagaacgtcgtggccgtcgcctgctacgaatac
tccagcgcctcctggcttgaggatcaggacttctggcgtctgcacggcctgttccgctcc
gtcgaactcgccgcccgcccgcatgtgcacatcgagaacacgcagatcgaagccgattgg
gatcccgaggccggcaccgcctccctcgatgccgcgctgaccgtgctcaacgcggccgac
gcggccacggtccgcgcgaccctgaaggacgccgacggcaacacggtgtggcagacgacg
ggcgacgcggaggcgcagaccgcgatctccagcgggccgctgcagggcatcgccccttgg
agcgccgaaagcccgacgctgtacgagcttgacgtcgacgtcatcgaccaggcgggcgac
gtcatcgaatgcacgtcccagaaggtcggtttccgccgcttccgcatcgaggacggcatc
ctgaccatcaacggcaagcgcatcgtgttcaagggcgccgaccgccacgagttcgacgcc
gaacggggccgcgccatcaccgagcaggacatgatcgatgacgtggtcttctgcaagcgc
cacaacatcaactccatccgcacctcgcactacccgaaccaggaacgctggtacgaactg
tgcgacgagtacggcatctacctgatcgacgagaccaacctcgaagcccacggcagctgg
tccctgcccggagacgtcctcaccgaggacaccatcgtgccgggtagcaagcgcgaatgg
gaaggcgcctgcgtcgaccgcgtcaacagcatgatgcgccgtgactacaaccacccgagc
gtgctgatctggtcgctgggcaacgaatcctacgtgggcgacgtgttccgcgccatgtac
aagcacgtgcacgacatcgacccgaaccgtccggtgcactacgagggcgtgactcacaac
cgtgactacgatgacgtcaccgacatcgagacccgtatgtactcgcatgccgacgagatc
gagaagtacctgaaggacgacccgaagaagccgtacctctcctgcgaatacatgcacgcc
atgggcaactccgtgggcaacatggacgaatacacggcgctcgaacgctacccgaagtat
cagggcggcttcatctgggacttcatcgaccaggccatctacgccacccagcccgacggc
accaggagcctgcgctacggcggagacttcggcgaccgtccgtccgactacgagttctcc
ggcgacggcctgctgttcgccgaccgcaagccttcccccaaggcccaggaagtcaagcag
ctgtactcgaacgtccacatcgacgtgacgaaggactcggtgtccgtcaagaacgacaac
ctgttcaccgccaccggcgactacgtgttcgtcctgagcattctcgccgacggcaagccg
gtctggcagtccacccggcgtttcgacgtgcccgccggtgagacccgcacgttcgatgtc
gcatggccggtggcggcgtaccgcgccgacgcccgcgaactggtgctgcaggtttcgcag
catctcgccaaggcgaccgattgggccgagagcggctacgagctcgctttcggacagacc
gtggtgcccgcggacgccaccgcgacgcccgacacgaagccggccgatgggaccatcacc
gtgggccgttggaacgccggcgtgcgaggcgccggacgcgaggtcctgctgtcgcgcacc
cagggcggcatggtctcctacaccttcgccggcaacgagttcgtgctgcgccgtcccgca
atcaccaccttccgtccgctgactgacaacgatcgcggcgccggtcatggcttcgagcgc
gtccagtggctgggcgccggacgctacgcccgctgcgtggacaacgtgctcgagcagatc
gacgacagcacgctcaagggcacgtacacgtatgagctcgccaccgcgcagcgcaccaag
gtgaccgtctcctacacggcccacaccgatggccgcgtgaacctgcacgtcgaataccct
ggagagcagggtgacctgcccaccatcccggcgttcggcatcgaatggacgctgcctgtg
cagtacacgaacctgaggttcttcggcaccggcccggaggagacgtacctggaccgcaaa
cacgccaagctcggcgtgtggagcaccaacgctttcgcggatcatgcgccgtacctcatg
ccgcaggagacgggcaaccatgaggatgtgcgttgggccgagattaccgacgatcacggc
cacggcatgcgcgtcagccgcgccgatggtgccgcgccgttcgcggtaagcctgttgccg
tactccagcttcatgcttgaggaggctcagcaccaggacgagctgccgaagccgaagcac
atgttcctgcgcgtccttgccgcacagatgggcgttggcggcgatgattcctggatgtcg
ccggtgcacccccagtaccatatcccggcggacaagccgatcagcctcgatgtcgacctc
gagctgatctga

DBGET integrated database retrieval system