KEGG   Bifidobacterium longum DJO10A: BLD_0752Help
Entry
BLD_0752          CDS       T00707                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863045..865297
Genome map
AA seq 750 aa AA seqDB search
MAKETKIEEDTVTVPVAQGDLDATSNAEFYNPHGVLGGHLGIGKHADTATIRVLRPLAKS
VTILTQDGEYPMTHEYNGVFVVTVPASGTKKQPTIPDYRVRTEWESGAVLIEDDPYRYMP
TVGDMDTYLFGEGRHEKLWETLGAHVLRYDDPMGGADGTPGEQVVGTAFSVWAPNAHAVR
VVGNFNAWDGRRHAMRELGSSGVWEIFIPGIGAGETYKFQILNANYTWEMKADPMERQHE
VPPNTASIVTESTYKWNDDAWMQHRRTTNPHDGPVSIYEVHAGSWRQGLTYRDLAKQLVD
YVKQEGFTHVEFMPLAQHPFSGSWGYQVTGYYAVDSRLGSPDDFRYLVDQFHQAGIGVIM
DWVPAHFPKDAFALGRFDGTPLYEDPDPLRGEHPEWGTYVFNFGRREVRNFLVANALFWL
EDLHVDALRVDAVSSMLYLDYSREPGHWRPNIYGGRENLEAIDFLKEATATAYKNNPGVM
VIAEESTAWPGITAPTSAGGIGFGMKWNMGWMHDTLEYLHEEPINRKWHHNEITFSMVYA
YSEHYVLPISHDEVVYGKGSLYGKMPGDDWQKLAGVRSMFAYQWAHPGKKLSFMGNELAQ
WGEWDHDASIDWDCLNWQEHRQVQTMVADLNAFYKAHPALWSQDFDPAGFQWLTSDDADH
NTLSFLRIGTKGETLAVVVNFSGEAWSDYQVALPTGGKWTEVFTTDDAKYGGSDIHNGTF
EAVEGEYHSRPFSAKITVPALGVVFLKPED
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaacgaagatcgaggaagataccgtcaccgtgcctgtcgcccaaggcgac
ctcgatgcgacgagcaatgctgaattctacaacccccacggagttctcggcgggcatctc
ggcatcggcaagcatgccgacaccgccacaatccgcgtgctgcgtccgcttgccaagtcc
gtgaccatcctcacccaggatggcgaatacccgatgacccacgaatacaacggcgtgttc
gtggttaccgtgccggcttccggcactaagaagcagcccacgattcccgactaccgtgtc
aggaccgagtgggaaagcggcgcagtgctcattgaggacgacccatatcgctatatgccc
acagtcggcgacatggacacctatctgttcggcgagggccgtcacgagaagctctgggag
acgcttggcgcgcatgtgctgcgctatgacgatccgatgggcggcgcagacggcacgccc
ggcgaacaggtggtaggcaccgcattctccgtgtgggccccgaacgcccatgccgtgcgc
gtagtcggtaacttcaacgcttgggatggccgccgtcatgccatgcgcgagctcggctcc
tccggcgtgtgggagatcttcatccccggaatcggcgcgggcgagacctacaagttccag
atcctgaacgccaattacacgtgggagatgaaggctgacccaatggagcgtcagcacgaa
gttccgccgaacaccgcctccatcgtcaccgaatccacctacaagtggaacgatgacgcc
tggatgcagcaccgccgcaccaccaacccgcatgatggcccggtctccatctatgaggtg
cacgccggcagctggaggcagggactgacctaccgcgacctggccaagcagctcgtggac
tacgtcaagcaggaaggcttcacccacgtggagttcatgccactggcccagcacccgttc
tccggctcctggggctatcaggtcaccggctactatgcggtcgactcccgtctcggttcc
cccgacgacttccgttacctggtcgaccagttccatcaggccggcatcggcgtgatcatg
gactgggtgcccgcccacttcccgaaggatgccttcgcgctcggccgcttcgacggcacc
ccgctgtacgaggacccggacccgctgcgcggcgaacaccctgaatggggcacctatgtg
ttcaacttcggacgccgcgaagtacgcaacttcctggtggccaacgccctgttctggctt
gaggacctgcacgtcgatgcactgcgcgtggatgccgtcagctccatgctctacctcgac
tacagccgcgaacccggccattggcgcccgaacatctacggcggacgcgagaacctggag
gccatcgacttcctcaaggaggccaccgccaccgcgtacaagaacaaccccggcgtcatg
gtgatcgccgaggagtccaccgcatggccgggcatcaccgcccccacttccgccggcggc
atcggcttcggcatgaagtggaacatgggctggatgcacgacaccctcgagtatctgcac
gaggagcccatcaaccgcaagtggcaccacaacgagatcaccttctccatggtgtacgcc
tactccgaacactacgtattgcccatcagccacgacgaagtcgtgtacggcaagggttcc
ctgtacggcaagatgccgggcgatgactggcagaagctggccggcgtgcgttcgatgttc
gcctatcagtgggctcacccaggcaagaagctctccttcatgggcaacgagctggcccag
tggggcgagtgggatcacgacgcctccatcgattgggattgcctgaactggcaggagcac
cgtcaggtccagaccatggtcgccgaccttaacgccttctacaaggcgcatccggcacta
tggagccaggacttcgacccggccggcttccagtggctgaccagcgacgatgccgaccac
aacacgctgagcttcctgcgcatcggtaccaagggcgagaccttggctgtggtggtcaac
ttctccggtgaggcctggtccgattaccaggtggcgctgcccaccggcggcaagtggacc
gaagtgttcaccaccgatgacgccaagtacggcggctccgacatccacaacggcaccttc
gaagcggtcgagggcgaatatcattcacgtccgttctcggcgaagatcaccgttccggct
ctgggagttgtattcttgaagccggaagactga

DBGET integrated database retrieval system