KEGG   Bifidobacterium longum DJO10A: BLD_0781Help
Entry
BLD_0781          CDS       T00707                                 

Gene name
bglX1
Definition
beta-glucosidase-like glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLD_0781 (bglX1)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BLD_0781 (bglX1)
Enzymes [BR:blj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BLD_0781 (bglX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899357..900535
Genome map
AA seq 392 aa AA seqDB search
MVLAGVAAYGWHVGWFAKSTSNGNTTTPQTSQTSALPRADVPSPKKNEPAAQAQRAVSAM
TLEERVGQLVMVPLLAGSDPSSLASTITDEHIGSAILIGNWNTGADTVKTATAQLQGYAP
AGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQLAAAGINVD
LAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRDAQVGAAVKHYPGLGA
VSGNTDFTTEGILDTTTTLGGAEAGAFDQAITKTDPAMVMMSLATYQSIDPNNPAVFSST
IIDGHIRNALKYTGVVISDSMSAEALSSYDVSQLGVKLVEAGGDMSCIGQTDYVKPIVDG
LNERAKSDPAFASKVTAAATRVMALKIKMGLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttggccggcgtggcagcctacggatggcatgtcggatggttcgccaaatccaca
tcaaacggcaacaccaccactccccagacctcccagacaagtgcgttaccacgcgccgac
gttccttccccgaagaagaacgaaccggccgcacaagcccaacgtgcggtatccgccatg
acacttgaggaacgtgtgggacagttagtgatggtgccgttgcttgccggttccgatccc
tcctcgttggcttcaacaatcaccgatgagcacattggctcggccattctcattggcaat
tggaataccggcgccgatacggtcaagaccgcgaccgcgcaactccaaggatatgcgccg
gccggcaatcgtctcatcatcgccaccgatcaggagggtggtcaggtgcagcatctgact
ggtaccggtttcgacacaatgcccagtgccgttgagcagggcacaatgtccgctgacgca
ttgcgtcaatcggcaggcacgtggggttcgcaattagctgctgctggcataaatgtcgat
ttggcaccggtgctcggcacggtggtgggcgatcgtgcctcaaatgctccgattggcgcg
ctggatcgtgatttcggattggatgcggccggcaacgccgaacatggcatcgccgttatt
gaaggtttgcgagacgctcaggtcggcgcggcggtcaaacattatcctgggttgggcgcg
gtaagcggcaataccgacttcaccaccgaaggcattctggatacgaccaccacgttgggc
ggggccgaggcaggtgcctttgaccaggcgatcaccaagaccgatcctgcgatggtgatg
atgtcgttggccacgtatcaatccatcgacccgaataatccggcggtgttttcttctacg
attatcgacggtcatattcgcaacgccctgaagtacacgggcgtggtgatttcggattcg
atgtctgccgaagcgttaagcagctacgatgtaagccaattgggagtaaagcttgtcgag
gcgggcggcgacatgtcctgcatcggtcagacggattacgtaaagccaattgtggacggc
ctcaacgaacgggcgaagtccgatccggctttcgcttcgaaagtgacggcggcggcgact
cgcgtaatggcattgaaaatcaagatgggactggcctga

DBGET integrated database retrieval system